MELO3C021402 (gene) Melon (DHL92) v3.5.1

NameMELO3C021402
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
DescriptionUvrABC system protein B
Locationchr11 : 26816957 .. 26817181 (-)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGGCCAGGCCTCTCACCAAAAAGTGGGGAAAACTTTGGGCTTTGGTAAATGGGCCATTTGTGGTTCAAATCAACGGGCCCATAAAGACGAGTTGAAGGAAAGAAAAAGAAAAGAAAACGTAACGATCCAAATTGAGAAGGTCCCAAATTTGACGCCAAAACTGGAGATCAAAGCTGCAAATCTTCGTTGTGAATTCAGAGGAAGTTACAGAGACAAAGAGTAG

mRNA sequence

ATGGGCCAGGCCTCTCACCAAAAAGTGGGGAAAACTTTGGGCTTTGGTAAATGGGCCATTTGTGGTTCAAATCAACGGGCCCATAAAGACGAGTTGAAGGAAAGAAAAAGAAAAGAAAACGTAACGATCCAAATTGAGAAGGTCCCAAATTTGACGCCAAAACTGGAGATCAAAGCTGCAAATCTTCGTTGTGAATTCAGAGGAAGTTACAGAGACAAAGAGTAG

Coding sequence (CDS)

ATGGGCCAGGCCTCTCACCAAAAAGTGGGGAAAACTTTGGGCTTTGGTAAATGGGCCATTTGTGGTTCAAATCAACGGGCCCATAAAGACGAGTTGAAGGAAAGAAAAAGAAAAGAAAACGTAACGATCCAAATTGAGAAGGTCCCAAATTTGACGCCAAAACTGGAGATCAAAGCTGCAAATCTTCGTTGTGAATTCAGAGGAAGTTACAGAGACAAAGAGTAG

Protein sequence

MGQASHQKVGKTLGFGKWAICGSNQRAHKDELKERKRKENVTIQIEKVPNLTPKLEIKAANLRCEFRGSYRDKE*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0003674 molecular_function
This gene is associated with the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
MU64188melon EST collection version 4.0transcribed_cluster

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C021402T1MELO3C021402T1mRNA


The following transcribed_cluster feature(s) are associated with this gene:

Feature NameUnique NameType
MU64188MU64188transcribed_cluster


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C021402Cucumber (Gy14) v2cgybmeB149
MELO3C021402Cucumber (Gy14) v2cgybmeB389
MELO3C021402Silver-seed gourdcarmeB0067
MELO3C021402Silver-seed gourdcarmeB0227
MELO3C021402Silver-seed gourdcarmeB0327
MELO3C021402Silver-seed gourdcarmeB0609
MELO3C021402Cucumber (Chinese Long) v3cucmeB176
MELO3C021402Cucumber (Chinese Long) v3cucmeB454
MELO3C021402Watermelon (97103) v2mewmbB123
MELO3C021402Watermelon (97103) v2mewmbB128
MELO3C021402Wax gourdmewgoB100
MELO3C021402Wax gourdmewgoB105
MELO3C021402Melon (DHL92) v3.5.1memeB051
MELO3C021402Cucumber (Gy14) v1cgymeB430
MELO3C021402Cucurbita maxima (Rimu)cmameB215
MELO3C021402Cucurbita maxima (Rimu)cmameB313
MELO3C021402Cucurbita maxima (Rimu)cmameB747
MELO3C021402Cucurbita maxima (Rimu)cmameB816
MELO3C021402Cucurbita moschata (Rifu)cmomeB200
MELO3C021402Cucurbita moschata (Rifu)cmomeB306
MELO3C021402Cucurbita moschata (Rifu)cmomeB738
MELO3C021402Cucurbita moschata (Rifu)cmomeB800
MELO3C021402Wild cucumber (PI 183967)cpimeB174
MELO3C021402Wild cucumber (PI 183967)cpimeB425
MELO3C021402Cucumber (Chinese Long) v2cumeB180
MELO3C021402Cucumber (Chinese Long) v2cumeB432
MELO3C021402Watermelon (Charleston Gray)mewcgB121
MELO3C021402Watermelon (Charleston Gray)mewcgB124
MELO3C021402Watermelon (97103) v1mewmB096
MELO3C021402Watermelon (97103) v1mewmB141
MELO3C021402Cucurbita pepo (Zucchini)cpemeB112
MELO3C021402Cucurbita pepo (Zucchini)cpemeB289
MELO3C021402Cucurbita pepo (Zucchini)cpemeB555
MELO3C021402Cucurbita pepo (Zucchini)cpemeB793
MELO3C021402Bottle gourd (USVL1VR-Ls)lsimeB017
MELO3C021402Bottle gourd (USVL1VR-Ls)lsimeB342