MELO3C021166 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTCCTTGTCCTTCTTCTCGTGGATTTAAATATATTCTTCTCGTTGTGGACTTTGTTTCCAAATGGGTGGAAGCAAAAGCCACTGTTACTGATGATTCTAAAGTGGTTGCAGGTTTTTTGAAGTCTAACATCCTTAACAAGTTTGGTTTTCCACGAGCTATCATTAGTGACCAGGGTCTAAAGAAATATGGTGTTCAACACCGCATTGCCACTCCATACCATCCTCAGACAAACAGGCAGGTGTAG ATGGGTCCTTGTCCTTCTTCTCGTGGATTTAAATATATTCTTCTCGTTGTGGACTTTGTTTCCAAATGGGTGGAAGCAAAAGCCACTGTTACTGATGATTCTAAAGTGGTTGCAGGTTTTTTGAAGTCTAACATCCTTAACAAGTTTGGTTTTCCACGAGCTATCATTAGTGACCAGGGTCTAAAGAAATATGGTGTTCAACACCGCATTGCCACTCCATACCATCCTCAGACAAACAGGCAGGTGTAG ATGGGTCCTTGTCCTTCTTCTCGTGGATTTAAATATATTCTTCTCGTTGTGGACTTTGTTTCCAAATGGGTGGAAGCAAAAGCCACTGTTACTGATGATTCTAAAGTGGTTGCAGGTTTTTTGAAGTCTAACATCCTTAACAAGTTTGGTTTTCCACGAGCTATCATTAGTGACCAGGGTCTAAAGAAATATGGTGTTCAACACCGCATTGCCACTCCATACCATCCTCAGACAAACAGGCAGGTGTAG MGPCPSSRGFKYILLVVDFVSKWVEAKATVTDDSKVVAGFLKSNILNKFGFPRAIISDQGLKKYGVQHRIATPYHPQTNRQV*
BLAST of MELO3C021166 vs. Swiss-Prot
Match: POL_XMRV4 (Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 6.2e-06 Identity = 30/89 (33.71%), Postives = 43/89 (48.31%), Query Frame = 1
BLAST of MELO3C021166 vs. Swiss-Prot
Match: POL_XMRV6 (Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 6.2e-06 Identity = 30/89 (33.71%), Postives = 43/89 (48.31%), Query Frame = 1
BLAST of MELO3C021166 vs. Swiss-Prot
Match: POL_XMRV3 (Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 8.2e-06 Identity = 30/89 (33.71%), Postives = 42/89 (47.19%), Query Frame = 1
BLAST of MELO3C021166 vs. Swiss-Prot
Match: POL_MLVRK (Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 8.2e-06 Identity = 29/89 (32.58%), Postives = 42/89 (47.19%), Query Frame = 1
BLAST of MELO3C021166 vs. Swiss-Prot
Match: POL_MLVRD (Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 8.2e-06 Identity = 29/89 (32.58%), Postives = 42/89 (47.19%), Query Frame = 1
BLAST of MELO3C021166 vs. TrEMBL
Match: A0A151QZW2_CAJCA (Transposon Ty3-G Gag-Pol polyprotein (Fragment) OS=Cajanus cajan GN=KK1_043040 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.3e-23 Identity = 59/92 (64.13%), Postives = 68/92 (73.91%), Query Frame = 1
BLAST of MELO3C021166 vs. TrEMBL
Match: A0A151UFE1_CAJCA (Retrotransposable element Tf2 OS=Cajanus cajan GN=KK1_049464 PE=4 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 5.1e-23 Identity = 59/92 (64.13%), Postives = 68/92 (73.91%), Query Frame = 1
BLAST of MELO3C021166 vs. TrEMBL
Match: A0A151UEQ4_CAJCA (Pro-Pol polyprotein OS=Cajanus cajan GN=KK1_049505 PE=4 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 8.7e-23 Identity = 57/92 (61.96%), Postives = 69/92 (75.00%), Query Frame = 1
BLAST of MELO3C021166 vs. TrEMBL
Match: X2JK86_SOYBN (Integrase OS=Glycine max PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.5e-22 Identity = 56/92 (60.87%), Postives = 68/92 (73.91%), Query Frame = 1
BLAST of MELO3C021166 vs. TrEMBL
Match: A0A151QTC2_CAJCA (Pol polyprotein (Fragment) OS=Cajanus cajan GN=KK1_045623 PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.5e-22 Identity = 56/88 (63.64%), Postives = 66/88 (75.00%), Query Frame = 1
BLAST of MELO3C021166 vs. NCBI nr
Match: gi|720093695|ref|XP_010246129.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104589483 [Nelumbo nucifera]) HSP 1 Score: 122.5 bits (306), Expect = 3.5e-25 Identity = 63/92 (68.48%), Postives = 68/92 (73.91%), Query Frame = 1
BLAST of MELO3C021166 vs. NCBI nr
Match: gi|720093695|ref|XP_010246129.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104589483 [Nelumbo nucifera]) HSP 1 Score: 104.4 bits (259), Expect = 9.9e-20 Identity = 53/92 (57.61%), Postives = 67/92 (72.83%), Query Frame = 1
HSP 2 Score: 116.7 bits (291), Expect = 1.9e-23 Identity = 59/92 (64.13%), Postives = 68/92 (73.91%), Query Frame = 1
BLAST of MELO3C021166 vs. NCBI nr
Match: gi|658046860|ref|XP_008359095.1| (PREDICTED: uncharacterized protein LOC103422814 [Malus domestica]) HSP 1 Score: 116.7 bits (291), Expect = 1.9e-23 Identity = 58/92 (63.04%), Postives = 68/92 (73.91%), Query Frame = 1
BLAST of MELO3C021166 vs. NCBI nr
Match: gi|657998510|ref|XP_008391660.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103453854 [Malus domestica]) HSP 1 Score: 115.9 bits (289), Expect = 3.3e-23 Identity = 58/92 (63.04%), Postives = 68/92 (73.91%), Query Frame = 1
BLAST of MELO3C021166 vs. NCBI nr
Match: gi|658031872|ref|XP_008351425.1| (PREDICTED: uncharacterized protein LOC103414836 [Malus domestica]) HSP 1 Score: 115.5 bits (288), Expect = 4.3e-23 Identity = 57/92 (61.96%), Postives = 68/92 (73.91%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |