MELO3C020758 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATTCAAGCTCTGAAACTTCTCATTTTTACAACAATTTCTTAGAGACAAAACCACTCAAACTCACTCCTCTTTGGCTCTTTCTTTCACTTAAATCAAATACAGAAATGGGATTTCGTCTGCCTACGCTTCTCCTCAATGCCAAGCAAATATTCAGAACGCAAGCTGTCTCAACAAGATGTCACTCCAACATTCCCAAAGGCCACATTGCAGTTTACGTGGGCGAGAATCGACGGAAGCGATTTGTGGTGCCGGTATCATACTTGAACCATCCTTCATTTCTAAGTTTGCTCAACAGAGCTGAAGAAGAGTTTGGATTCAACCATCCAAGTGGGGGTTTGACAATTCCCTGCAAAGAAGATGCCTTCATTGATCTCACTTCAAGATTGCATACCTCGTGA ATTCAAGCTCTGAAACTTCTCATTTTTACAACAATTTCTTAGAGACAAAACCACTCAAACTCACTCCTCTTTGGCTCTTTCTTTCACTTAAATCAAATACAGAAATGGGATTTCGTCTGCCTACGCTTCTCCTCAATGCCAAGCAAATATTCAGAACGCAAGCTGTCTCAACAAGATGTCACTCCAACATTCCCAAAGGCCACATTGCAGTTTACGTGGGCGAGAATCGACGGAAGCGATTTGTGGTGCCGGTATCATACTTGAACCATCCTTCATTTCTAAGTTTGCTCAACAGAGCTGAAGAAGAGTTTGGATTCAACCATCCAAGTGGGGGTTTGACAATTCCCTGCAAAGAAGATGCCTTCATTGATCTCACTTCAAGATTGCATACCTCGTGA ATGGGATTTCGTCTGCCTACGCTTCTCCTCAATGCCAAGCAAATATTCAGAACGCAAGCTGTCTCAACAAGATGTCACTCCAACATTCCCAAAGGCCACATTGCAGTTTACGTGGGCGAGAATCGACGGAAGCGATTTGTGGTGCCGGTATCATACTTGAACCATCCTTCATTTCTAAGTTTGCTCAACAGAGCTGAAGAAGAGTTTGGATTCAACCATCCAAGTGGGGGTTTGACAATTCCCTGCAAAGAAGATGCCTTCATTGATCTCACTTCAAGATTGCATACCTCGTGA MGFRLPTLLLNAKQIFRTQAVSTRCHSNIPKGHIAVYVGENRRKRFVVPVSYLNHPSFLSLLNRAEEEFGFNHPSGGLTIPCKEDAFIDLTSRLHTS*
BLAST of MELO3C020758 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.3e-23 Identity = 54/86 (62.79%), Postives = 66/86 (76.74%), Query Frame = 1
BLAST of MELO3C020758 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.3e-23 Identity = 53/87 (60.92%), Postives = 67/87 (77.01%), Query Frame = 1
BLAST of MELO3C020758 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 6.6e-23 Identity = 52/85 (61.18%), Postives = 65/85 (76.47%), Query Frame = 1
BLAST of MELO3C020758 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.1e-22 Identity = 52/86 (60.47%), Postives = 66/86 (76.74%), Query Frame = 1
BLAST of MELO3C020758 vs. Swiss-Prot
Match: SAU19_ARATH (Auxin-responsive protein SAUR19 OS=Arabidopsis thaliana GN=SAUR19 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 3.3e-22 Identity = 52/86 (60.47%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of MELO3C020758 vs. TrEMBL
Match: A0A0A0LPH3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258670 PE=4 SV=1) HSP 1 Score: 185.3 bits (469), Expect = 3.6e-44 Identity = 88/97 (90.72%), Postives = 93/97 (95.88%), Query Frame = 1
BLAST of MELO3C020758 vs. TrEMBL
Match: A0A0A0LIZ4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258710 PE=4 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 5.1e-38 Identity = 74/97 (76.29%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of MELO3C020758 vs. TrEMBL
Match: A0A0A0LM65_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258730 PE=4 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 2.5e-37 Identity = 73/97 (75.26%), Postives = 90/97 (92.78%), Query Frame = 1
BLAST of MELO3C020758 vs. TrEMBL
Match: A0A0A0LLF7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258750 PE=4 SV=1) HSP 1 Score: 158.3 bits (399), Expect = 4.8e-36 Identity = 71/97 (73.20%), Postives = 88/97 (90.72%), Query Frame = 1
BLAST of MELO3C020758 vs. TrEMBL
Match: A0A0A0LPG7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258620 PE=4 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 1.8e-35 Identity = 73/97 (75.26%), Postives = 85/97 (87.63%), Query Frame = 1
BLAST of MELO3C020758 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 114.4 bits (285), Expect = 4.0e-26 Identity = 56/99 (56.57%), Postives = 69/99 (69.70%), Query Frame = 1
BLAST of MELO3C020758 vs. TAIR10
Match: AT2G21210.1 (AT2G21210.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 111.3 bits (277), Expect = 3.4e-25 Identity = 56/98 (57.14%), Postives = 72/98 (73.47%), Query Frame = 1
BLAST of MELO3C020758 vs. TAIR10
Match: AT5G18080.1 (AT5G18080.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 109.4 bits (272), Expect = 1.3e-24 Identity = 54/86 (62.79%), Postives = 66/86 (76.74%), Query Frame = 1
BLAST of MELO3C020758 vs. TAIR10
Match: AT5G18060.1 (AT5G18060.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 109.4 bits (272), Expect = 1.3e-24 Identity = 53/87 (60.92%), Postives = 67/87 (77.01%), Query Frame = 1
BLAST of MELO3C020758 vs. TAIR10
Match: AT4G34800.1 (AT4G34800.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 108.2 bits (269), Expect = 2.9e-24 Identity = 55/92 (59.78%), Postives = 66/92 (71.74%), Query Frame = 1
BLAST of MELO3C020758 vs. NCBI nr
Match: gi|659115586|ref|XP_008457629.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 201.1 bits (510), Expect = 9.2e-49 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of MELO3C020758 vs. NCBI nr
Match: gi|778669580|ref|XP_011649270.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 185.3 bits (469), Expect = 5.2e-44 Identity = 88/97 (90.72%), Postives = 93/97 (95.88%), Query Frame = 1
BLAST of MELO3C020758 vs. NCBI nr
Match: gi|449458550|ref|XP_004147010.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 164.9 bits (416), Expect = 7.3e-38 Identity = 74/97 (76.29%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of MELO3C020758 vs. NCBI nr
Match: gi|659115590|ref|XP_008457631.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 162.5 bits (410), Expect = 3.6e-37 Identity = 73/97 (75.26%), Postives = 88/97 (90.72%), Query Frame = 1
BLAST of MELO3C020758 vs. NCBI nr
Match: gi|778669591|ref|XP_011649272.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 162.5 bits (410), Expect = 3.6e-37 Identity = 73/97 (75.26%), Postives = 90/97 (92.78%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|