MELO3C020640.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TGATTCCTAGGATGGTTAACGATGGCTTTGATGGGTGGTTTTGCTAGAATAGGGAATAATGAGGCCACTATTTTAGTCAATGATGGGGAGAAGGTTGGTGACATTGATCCACAAGAAGCTCAGCAAACTCTTGAAATAGCGGTAGCCAACTTGAGGAAAGGTCAGGGCAAGAGACAAAGAATCGAGGCAAATTGAGCTCTCAGACGA TGATTCCTAGGATGGTTAACGATGGCTTTGATGGGTGGTTTTGCTAGAATAGGGAATAATGAGGCCACTATTTTAGTCAATGATGGGGAGAAGGTTGGTGACATTGATCCACAAGAAGCTCAGCAAACTCTTGAAATAGCGGTAGCCAACTTGAGGAAAGGTCAGGGCAAGAGACAAAGAATCGAGGCAAATTGAGCTCTCAGACGA ATGGCTTTGATGGGTGGTTTTGCTAGAATAGGGAATAATGAGGCCACTATTTTAGTCAATGATGGGGAGAAGGTTGGTGACATTGATCCACAAGAAGCTCAGCAAACTCTTGAAATAGCGGTAGCCAACTTGAGGAAAGGTCAGGGCAAGAGACAAAGAATCGAGGCAAATTGA MALMGGFARIGNNEATILVNDGEKVGDIDPQEAQQTLEIAVANLRKGQGKRQRIEAN
BLAST of MELO3C020640.2 vs. NCBI nr
Match: ADM63624.1 (ATP synthase CF1 epsilon subunit, partial (chloroplast) [Abrophyllum ornans]) HSP 1 Score: 98.6 bits (244), Expect = 7.3e-18 Identity = 49/57 (85.96%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of MELO3C020640.2 vs. NCBI nr
Match: ADM63635.1 (ATP synthase CF1 epsilon subunit, partial (chloroplast) [Cuttsia viburnea]) HSP 1 Score: 98.6 bits (244), Expect = 7.3e-18 Identity = 49/57 (85.96%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of MELO3C020640.2 vs. NCBI nr
Match: AKZ30339.1 (ATP synthase CF1 epsilon subunit (chloroplast) [Goodenia hassallii]) HSP 1 Score: 98.2 bits (243), Expect = 9.5e-18 Identity = 49/57 (85.96%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of MELO3C020640.2 vs. NCBI nr
Match: ADM63673.1 (ATP synthase CF1 epsilon subunit, partial (chloroplast) [Villarsia sp. Fay s.n.]) HSP 1 Score: 97.8 bits (242), Expect = 1.2e-17 Identity = 49/57 (85.96%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of MELO3C020640.2 vs. NCBI nr
Match: ALO21750.1 (AtpE (plastid) [Cucurbita argyrosperma] >ALO21827.1 AtpE (plastid) [Cucurbita argyrosperma var. palmeri]) HSP 1 Score: 97.8 bits (242), Expect = 1.2e-17 Identity = 50/57 (87.72%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of MELO3C020640.2 vs. TAIR10
Match: ATCG00470.1 (ATP synthase epsilon chain) HSP 1 Score: 95.1 bits (235), Expect = 1.5e-20 Identity = 49/57 (85.96%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of MELO3C020640.2 vs. Swiss-Prot
Match: sp|Q4VZG9|ATPE_CUCSA (ATP synthase epsilon chain, chloroplastic OS=Cucumis sativus OX=3659 GN=atpE PE=3 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 4.1e-20 Identity = 50/57 (87.72%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of MELO3C020640.2 vs. Swiss-Prot
Match: sp|P09468|ATPE_ARATH (ATP synthase epsilon chain, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=atpE PE=1 SV=2) HSP 1 Score: 95.1 bits (235), Expect = 2.6e-19 Identity = 49/57 (85.96%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of MELO3C020640.2 vs. Swiss-Prot
Match: sp|Q06RC3|ATPE_JASNU (ATP synthase epsilon chain, chloroplastic OS=Jasminum nudiflorum OX=126431 GN=atpE PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 4.5e-19 Identity = 47/57 (82.46%), Postives = 51/57 (89.47%), Query Frame = 0
BLAST of MELO3C020640.2 vs. Swiss-Prot
Match: sp|Q332X2|ATPE_LACSA (ATP synthase epsilon chain, chloroplastic OS=Lactuca sativa OX=4236 GN=atpE PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 4.5e-19 Identity = 48/57 (84.21%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of MELO3C020640.2 vs. Swiss-Prot
Match: sp|Q14FF1|ATPE_POPAL (ATP synthase epsilon chain, chloroplastic OS=Populus alba OX=43335 GN=atpE PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 4.5e-19 Identity = 48/57 (84.21%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of MELO3C020640.2 vs. TrEMBL
Match: tr|E0XEI1|E0XEI1_9ASTR (ATP synthase epsilon chain, chloroplastic (Fragment) OS=Cuttsia viburnea OX=54176 GN=atpE PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 4.8e-18 Identity = 49/57 (85.96%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of MELO3C020640.2 vs. TrEMBL
Match: tr|E0XEH0|E0XEH0_ABROR (ATP synthase epsilon chain, chloroplastic (Fragment) OS=Abrophyllum ornans OX=49579 GN=atpE PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 4.8e-18 Identity = 49/57 (85.96%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of MELO3C020640.2 vs. TrEMBL
Match: tr|A0A0K1ZVL8|A0A0K1ZVL8_9ASTR (ATP synthase epsilon chain, chloroplastic OS=Goodenia hassallii OX=1690104 GN=atpE PE=3 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 6.3e-18 Identity = 49/57 (85.96%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of MELO3C020640.2 vs. TrEMBL
Match: tr|X2EZM8|X2EZM8_LAGSI (ATP synthase epsilon chain, chloroplastic OS=Lagenaria siceraria OX=3668 GN=atpE PE=3 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 8.2e-18 Identity = 50/57 (87.72%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of MELO3C020640.2 vs. TrEMBL
Match: tr|A0A249RXP3|A0A249RXP3_CUCME (ATP synthase epsilon chain, chloroplastic OS=Cucumis melo subsp. agrestis OX=217619 GN=atpE PE=3 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 8.2e-18 Identity = 50/57 (87.72%), Postives = 50/57 (87.72%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|