MELO3C020639.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGGAAGAAGATCTTGTCAAGCGCATTGGATTGATTGTGGATGTTTCGGCGGGAAAGGCTATGCTCGGGCGTGTGGTCGACGCCTTGGGAGCACCCATTGATGGAAGAGGGGCTCTCAGCGATCACGAGCGAAGACGTGTCGAAGTGAAAGCCCCTGGGATTATTGAACGTAAATCAGTGCACGAGCCTATGCAAACAGGCTTAAAAGCAGTGGATAGCCTGGTTCCCATAGGCCTGGGCCAACGAGAACGGAGAATCGGGGACCGACAAACTGGAAAAACTGCTATAGCACAAATATAA ATGAAGGAAGAAGATCTTGTCAAGCGCATTGGATTGATTGTGGATGTTTCGGCGGGAAAGGCTATGCTCGGGCGTGTGGTCGACGCCTTGGGAGCACCCATTGATGGAAGAGGGGCTCTCAGCGATCACGAGCGAAGACGTGTCGAAGTGAAAGCCCCTGGGATTATTGAACGTAAATCAGTGCACGAGCCTATGCAAACAGGCTTAAAAGCAGTGGATAGCCTGGTTCCCATAGGCCTGGGCCAACGAGAACGGAGAATCGGGGACCGACAAACTGGAAAAACTGCTATAGCACAAATATAA ATGAAGGAAGAAGATCTTGTCAAGCGCATTGGATTGATTGTGGATGTTTCGGCGGGAAAGGCTATGCTCGGGCGTGTGGTCGACGCCTTGGGAGCACCCATTGATGGAAGAGGGGCTCTCAGCGATCACGAGCGAAGACGTGTCGAAGTGAAAGCCCCTGGGATTATTGAACGTAAATCAGTGCACGAGCCTATGCAAACAGGCTTAAAAGCAGTGGATAGCCTGGTTCCCATAGGCCTGGGCCAACGAGAACGGAGAATCGGGGACCGACAAACTGGAAAAACTGCTATAGCACAAATATAA MKEEDLVKRIGLIVDVSAGKAMLGRVVDALGAPIDGRGALSDHERRRVEVKAPGIIERKSVHEPMQTGLKAVDSLVPIGLGQRERRIGDRQTGKTAIAQI
BLAST of MELO3C020639.2 vs. NCBI nr
Match: ACD71521.1 (F1-ATPase alpha subunit, partial (mitochondrion) [Dictyostega orobanchoides]) HSP 1 Score: 173.3 bits (438), Expect = 4.1e-40 Identity = 90/98 (91.84%), Postives = 91/98 (92.86%), Query Frame = 0
BLAST of MELO3C020639.2 vs. NCBI nr
Match: AAQ74502.1 (F1-ATPase alpha subunit, partial (mitochondrion) [Calopogon tuberosus]) HSP 1 Score: 172.6 bits (436), Expect = 7.0e-40 Identity = 90/98 (91.84%), Postives = 90/98 (91.84%), Query Frame = 0
BLAST of MELO3C020639.2 vs. NCBI nr
Match: ABD61037.1 (ATPase alpha subunit, partial (mitochondrion) [Oncidium sphacelatum]) HSP 1 Score: 172.6 bits (436), Expect = 7.0e-40 Identity = 90/98 (91.84%), Postives = 90/98 (91.84%), Query Frame = 0
BLAST of MELO3C020639.2 vs. NCBI nr
Match: AFD29870.1 (ATP synthase alpha subunit, partial (mitochondrion) [Phalaenopsis violacea]) HSP 1 Score: 172.6 bits (436), Expect = 7.0e-40 Identity = 90/98 (91.84%), Postives = 90/98 (91.84%), Query Frame = 0
BLAST of MELO3C020639.2 vs. NCBI nr
Match: AFY08517.1 (ATPase subunit 1, partial (mitochondrion) [Eleusine coracana]) HSP 1 Score: 172.2 bits (435), Expect = 9.1e-40 Identity = 90/98 (91.84%), Postives = 91/98 (92.86%), Query Frame = 0
BLAST of MELO3C020639.2 vs. TAIR10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein) HSP 1 Score: 165.2 bits (417), Expect = 2.0e-41 Identity = 84/98 (85.71%), Postives = 89/98 (90.82%), Query Frame = 0
BLAST of MELO3C020639.2 vs. TAIR10
Match: ATMG01190.1 (ATP synthase subunit 1) HSP 1 Score: 162.5 bits (410), Expect = 1.3e-40 Identity = 83/98 (84.69%), Postives = 88/98 (89.80%), Query Frame = 0
BLAST of MELO3C020639.2 vs. TAIR10
Match: ATCG00120.1 (ATP synthase subunit alpha) HSP 1 Score: 114.0 bits (284), Expect = 5.3e-26 Identity = 57/98 (58.16%), Postives = 72/98 (73.47%), Query Frame = 0
BLAST of MELO3C020639.2 vs. TAIR10
Match: AT5G08670.1 (ATP synthase alpha/beta family protein) HSP 1 Score: 55.8 bits (133), Expect = 1.7e-08 Identity = 30/91 (32.97%), Postives = 45/91 (49.45%), Query Frame = 0
BLAST of MELO3C020639.2 vs. TAIR10
Match: AT5G08680.1 (ATP synthase alpha/beta family protein) HSP 1 Score: 55.8 bits (133), Expect = 1.7e-08 Identity = 30/91 (32.97%), Postives = 45/91 (49.45%), Query Frame = 0
BLAST of MELO3C020639.2 vs. Swiss-Prot
Match: sp|Q06735|ATPAM_BETVU (ATP synthase subunit alpha, mitochondrial OS=Beta vulgaris OX=161934 GN=ATPA PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 8.7e-42 Identity = 89/98 (90.82%), Postives = 90/98 (91.84%), Query Frame = 0
BLAST of MELO3C020639.2 vs. Swiss-Prot
Match: sp|P18260|ATPAM_HELAN (ATP synthase subunit alpha, mitochondrial OS=Helianthus annuus OX=4232 GN=ATPA PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 8.7e-42 Identity = 89/98 (90.82%), Postives = 90/98 (91.84%), Query Frame = 0
BLAST of MELO3C020639.2 vs. Swiss-Prot
Match: sp|P05493|ATPAM_PEA (ATP synthase subunit alpha, mitochondrial OS=Pisum sativum OX=3888 GN=ATPA PE=3 SV=2) HSP 1 Score: 170.6 bits (431), Expect = 8.7e-42 Identity = 89/98 (90.82%), Postives = 90/98 (91.84%), Query Frame = 0
BLAST of MELO3C020639.2 vs. Swiss-Prot
Match: sp|P24459|ATPAM_PHAVU (ATP synthase subunit alpha, mitochondrial OS=Phaseolus vulgaris OX=3885 GN=ATPA PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 8.7e-42 Identity = 89/98 (90.82%), Postives = 90/98 (91.84%), Query Frame = 0
BLAST of MELO3C020639.2 vs. Swiss-Prot
Match: sp|Q01915|ATPAM_SOYBN (ATP synthase subunit alpha, mitochondrial OS=Glycine max OX=3847 GN=ATPA PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 8.7e-42 Identity = 89/98 (90.82%), Postives = 90/98 (91.84%), Query Frame = 0
BLAST of MELO3C020639.2 vs. TrEMBL
Match: tr|B3FTS7|B3FTS7_9LILI (ATP synthase subunit alpha (Fragment) OS=Dictyostega orobanchoides OX=396663 GN=atpA PE=3 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 2.7e-40 Identity = 90/98 (91.84%), Postives = 91/98 (92.86%), Query Frame = 0
BLAST of MELO3C020639.2 vs. TrEMBL
Match: tr|A1XIS8|A1XIS8_ONCSH (ATP synthase subunit alpha (Fragment) OS=Oncidium sphacelatum OX=48524 GN=atp1 PE=3 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 4.6e-40 Identity = 90/98 (91.84%), Postives = 90/98 (91.84%), Query Frame = 0
BLAST of MELO3C020639.2 vs. TrEMBL
Match: tr|Q5VL65|Q5VL65_CALTU (ATP synthase subunit alpha (Fragment) OS=Calopogon tuberosus OX=78712 GN=atpA PE=3 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 4.6e-40 Identity = 90/98 (91.84%), Postives = 90/98 (91.84%), Query Frame = 0
BLAST of MELO3C020639.2 vs. TrEMBL
Match: tr|I1TL01|I1TL01_9ASPA (ATP synthase subunit alpha (Fragment) OS=Phalaenopsis violacea OX=86509 GN=atp1 PE=4 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 4.6e-40 Identity = 90/98 (91.84%), Postives = 90/98 (91.84%), Query Frame = 0
BLAST of MELO3C020639.2 vs. TrEMBL
Match: tr|K9N0G2|K9N0G2_ELECO (ATPase subunit 1 (Fragment) OS=Eleusine coracana OX=4511 GN=ATP1 PE=4 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 6.0e-40 Identity = 90/98 (91.84%), Postives = 91/98 (92.86%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|