MELO3C020572 (gene) Melon (DHL92) v3.5.1

NameMELO3C020572
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
DescriptionHelicase, putative
Locationchr12 : 1084342 .. 1084608 (+)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGCTAAGTCTGGTTGGCGAGGACAAGAGCAGCAGTGTGTGGGGGTTCGCGTGCTGGATTGCATGCAGGCGTGCAGGTTTGCATTCAGCTTTATAGAAAATTGTTGTGGCGCATGTGGCTGAAGGGAGAGGACTGGCCAGCGTGCTTTGAAGGCGGCAGAACCAGTCATCTATGGCAGCGCTGATCCGGCCATTGACGACGACGGCTGTCTTGCCAGCAGTGTGGGTCCTCTTTGTTCAGGTTTCATTAAGTGTAATGTCATCTAA

mRNA sequence

ATGGCTAAGTCTGGTTGGCGAGGACAAGAGCAGCAGTGTGTGGGGGTTCGCGTGCTGGATTGCATGCAGGCGTGCAGGGAGAGGACTGGCCAGCGTGCTTTGAAGGCGGCAGAACCAGTCATCTATGGCAGCGCTGATCCGGCCATTGACGACGACGGCTGTCTTGCCAGCAGTGTGGGTCCTCTTTGTTCAGGTTTCATTAAGTGTAATGTCATCTAA

Coding sequence (CDS)

ATGGCTAAGTCTGGTTGGCGAGGACAAGAGCAGCAGTGTGTGGGGGTTCGCGTGCTGGATTGCATGCAGGCGTGCAGGGAGAGGACTGGCCAGCGTGCTTTGAAGGCGGCAGAACCAGTCATCTATGGCAGCGCTGATCCGGCCATTGACGACGACGGCTGTCTTGCCAGCAGTGTGGGTCCTCTTTGTTCAGGTTTCATTAAGTGTAATGTCATCTAA

Protein sequence

MAKSGWRGQEQQCVGVRVLDCMQACRERTGQRALKAAEPVIYGSADPAIDDDGCLASSVGPLCSGFIKCNVI*
The following terms have been associated with this gene:
Vocabulary: INTERPRO
TermDefinition
IPR012961Ski2_C
IPR025696rRNA_proc-arch_dom
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006813 potassium ion transport
biological_process GO:0035864 response to potassium ion
biological_process GO:0006401 RNA catabolic process
cellular_component GO:0005773 vacuole
molecular_function GO:0005524 ATP binding
molecular_function GO:0003723 RNA binding
molecular_function GO:0003724 RNA helicase activity
This gene is associated with the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
MU58519melon EST collection version 4.0transcribed_cluster

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C020572T1MELO3C020572T1mRNA
MELO3C020572T2MELO3C020572T2mRNA


The following transcribed_cluster feature(s) are associated with this gene:

Feature NameUnique NameType
MU58519MU58519transcribed_cluster


Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012961ATP-dependent RNA helicase Ski2, C-terminalPFAMPF08148DSHCTcoord: 289..353
score: 2.3
IPR012961ATP-dependent RNA helicase Ski2, C-terminalSMARTSM01142DSHCT_2coord: 285..377
score: 7.
IPR025696rRNA-processing arch domainPFAMPF13234rRNA_proc-archcoord: 6..261
score: 7.6
NoneNo IPR availableunknownCoilCoilcoord: 239..259
scor

The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C020572Silver-seed gourdcarmeB0159
MELO3C020572Silver-seed gourdcarmeB0388
MELO3C020572Silver-seed gourdcarmeB0449
MELO3C020572Silver-seed gourdcarmeB0971
MELO3C020572Cucumber (Chinese Long) v3cucmeB025
MELO3C020572Cucumber (Chinese Long) v3cucmeB183
MELO3C020572Cucumber (Chinese Long) v3cucmeB465
MELO3C020572Watermelon (97103) v2mewmbB148
MELO3C020572Watermelon (97103) v2mewmbB153
MELO3C020572Watermelon (97103) v2mewmbB160
MELO3C020572Wax gourdmewgoB152
MELO3C020572Wax gourdmewgoB161
MELO3C020572Melon (DHL92) v3.5.1memeB069
MELO3C020572Melon (DHL92) v3.5.1memeB072
MELO3C020572Cucumber (Gy14) v1cgymeB220
MELO3C020572Cucumber (Gy14) v1cgymeB243
MELO3C020572Cucumber (Gy14) v1cgymeB313
MELO3C020572Cucurbita maxima (Rimu)cmameB194
MELO3C020572Cucurbita maxima (Rimu)cmameB216
MELO3C020572Cucurbita maxima (Rimu)cmameB391
MELO3C020572Cucurbita maxima (Rimu)cmameB669
MELO3C020572Cucurbita maxima (Rimu)cmameB750
MELO3C020572Cucurbita moschata (Rifu)cmomeB181
MELO3C020572Cucurbita moschata (Rifu)cmomeB201
MELO3C020572Cucurbita moschata (Rifu)cmomeB382
MELO3C020572Cucurbita moschata (Rifu)cmomeB662
MELO3C020572Cucurbita moschata (Rifu)cmomeB742
MELO3C020572Wild cucumber (PI 183967)cpimeB025
MELO3C020572Wild cucumber (PI 183967)cpimeB180
MELO3C020572Wild cucumber (PI 183967)cpimeB454
MELO3C020572Cucumber (Chinese Long) v2cumeB028
MELO3C020572Cucumber (Chinese Long) v2cumeB185
MELO3C020572Cucumber (Chinese Long) v2cumeB459
MELO3C020572Watermelon (Charleston Gray)mewcgB128
MELO3C020572Watermelon (Charleston Gray)mewcgB155
MELO3C020572Watermelon (Charleston Gray)mewcgB149
MELO3C020572Watermelon (97103) v1mewmB145
MELO3C020572Watermelon (97103) v1mewmB146
MELO3C020572Watermelon (97103) v1mewmB175
MELO3C020572Cucurbita pepo (Zucchini)cpemeB479
MELO3C020572Cucurbita pepo (Zucchini)cpemeB492
MELO3C020572Bottle gourd (USVL1VR-Ls)lsimeB174
MELO3C020572Bottle gourd (USVL1VR-Ls)lsimeB245
MELO3C020572Cucumber (Gy14) v2cgybmeB023
MELO3C020572Cucumber (Gy14) v2cgybmeB155
MELO3C020572Cucumber (Gy14) v2cgybmeB398