MELO3C020445 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAACTAGATCAAGCTGCTTCAGATCAGAAATCTCCGGCTACTGTACAAACTTTACTATTAAATCAAGGACCACCCAGGGCTTCAGATATACCATGGGTTGCTTTAATTGGTCAGTTTATTTCAATTGCTACTGCACAGTCTGGTTCTGTTGGCTCTGAAAATTCTTTGGAAACTGTATGGAGAGCCGAGAGTGAAAGTCTGAAATCCATACTGACTGGAGCCCCTTAG ATGGAACTAGATCAAGCTGCTTCAGATCAGAAATCTCCGGCTACTGTACAAACTTTACTATTAAATCAAGGACCACCCAGGGCTTCAGATATACCATGGGTTGCTTTAATTGGTCAGTTTATTTCAATTGCTACTGCACAGTCTGGTTCTGTTGGCTCTGAAAATTCTTTGGAAACTGTATGGAGAGCCGAGAGTGAAAGTCTGAAATCCATACTGACTGGAGCCCCTTAG ATGGAACTAGATCAAGCTGCTTCAGATCAGAAATCTCCGGCTACTGTACAAACTTTACTATTAAATCAAGGACCACCCAGGGCTTCAGATATACCATGGGTTGCTTTAATTGGTCAGTTTATTTCAATTGCTACTGCACAGTCTGGTTCTGTTGGCTCTGAAAATTCTTTGGAAACTGTATGGAGAGCCGAGAGTGAAAGTCTGAAATCCATACTGACTGGAGCCCCTTAG MELDQAASDQKSPATVQTLLLNQGPPRASDIPWVALIGQFISIATAQSGSVGSENSLETVWRAESESLKSILTGAP*
BLAST of MELO3C020445 vs. Swiss-Prot
Match: PPA15_ARATH (Purple acid phosphatase 15 OS=Arabidopsis thaliana GN=PAP15 PE=1 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 3.6e-36 Identity = 70/102 (68.63%), Postives = 82/102 (80.39%), Query Frame = 1
BLAST of MELO3C020445 vs. Swiss-Prot
Match: PPA13_ARATH (Purple acid phosphatase 13 OS=Arabidopsis thaliana GN=PAP13 PE=2 SV=2) HSP 1 Score: 112.8 bits (281), Expect = 2.4e-24 Identity = 54/95 (56.84%), Postives = 63/95 (66.32%), Query Frame = 1
BLAST of MELO3C020445 vs. Swiss-Prot
Match: PPA25_ARATH (Purple acid phosphatase 25 OS=Arabidopsis thaliana GN=PAP25 PE=2 SV=2) HSP 1 Score: 65.1 bits (157), Expect = 5.7e-10 Identity = 27/45 (60.00%), Postives = 31/45 (68.89%), Query Frame = 1
BLAST of MELO3C020445 vs. Swiss-Prot
Match: PPA6_ARATH (Purple acid phosphatase 6 OS=Arabidopsis thaliana GN=PAP6 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 5.7e-10 Identity = 27/45 (60.00%), Postives = 31/45 (68.89%), Query Frame = 1
BLAST of MELO3C020445 vs. Swiss-Prot
Match: PPAF2_IPOBA (Purple acid phosphatase 2 OS=Ipomoea batatas GN=PAP2 PE=1 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.3e-09 Identity = 25/41 (60.98%), Postives = 30/41 (73.17%), Query Frame = 1
BLAST of MELO3C020445 vs. TrEMBL
Match: A0A0A0LL67_CUCSA (Purple acid phosphatase OS=Cucumis sativus GN=Csa_2G139300 PE=3 SV=1) HSP 1 Score: 242.3 bits (617), Expect = 2.9e-61 Identity = 108/113 (95.58%), Postives = 111/113 (98.23%), Query Frame = 1
BLAST of MELO3C020445 vs. TrEMBL
Match: A0A068URS0_COFCA (Purple acid phosphatase OS=Coffea canephora GN=GSCOC_T00033171001 PE=3 SV=1) HSP 1 Score: 193.7 bits (491), Expect = 1.2e-46 Identity = 85/102 (83.33%), Postives = 91/102 (89.22%), Query Frame = 1
BLAST of MELO3C020445 vs. TrEMBL
Match: V9NC38_MANES (Purple acid phosphatase OS=Manihot esculenta GN=PAP15-1 PE=2 SV=1) HSP 1 Score: 193.4 bits (490), Expect = 1.6e-46 Identity = 86/102 (84.31%), Postives = 91/102 (89.22%), Query Frame = 1
BLAST of MELO3C020445 vs. TrEMBL
Match: A0A0V0IHA7_SOLCH (Putative purple acid phosphatase 15-like OS=Solanum chacoense PE=4 SV=1) HSP 1 Score: 191.8 bits (486), Expect = 4.5e-46 Identity = 84/102 (82.35%), Postives = 91/102 (89.22%), Query Frame = 1
BLAST of MELO3C020445 vs. TrEMBL
Match: M1D3F2_SOLTU (Purple acid phosphatase OS=Solanum tuberosum GN=PGSC0003DMG400031296 PE=3 SV=1) HSP 1 Score: 191.0 bits (484), Expect = 7.7e-46 Identity = 83/102 (81.37%), Postives = 91/102 (89.22%), Query Frame = 1
BLAST of MELO3C020445 vs. TAIR10
Match: AT3G07130.1 (AT3G07130.1 purple acid phosphatase 15) HSP 1 Score: 152.1 bits (383), Expect = 2.0e-37 Identity = 70/102 (68.63%), Postives = 82/102 (80.39%), Query Frame = 1
BLAST of MELO3C020445 vs. TAIR10
Match: AT2G32770.3 (AT2G32770.3 purple acid phosphatase 13) HSP 1 Score: 112.8 bits (281), Expect = 1.4e-25 Identity = 54/95 (56.84%), Postives = 63/95 (66.32%), Query Frame = 1
BLAST of MELO3C020445 vs. TAIR10
Match: AT1G56360.1 (AT1G56360.1 purple acid phosphatase 6) HSP 1 Score: 65.1 bits (157), Expect = 3.2e-11 Identity = 27/45 (60.00%), Postives = 31/45 (68.89%), Query Frame = 1
BLAST of MELO3C020445 vs. TAIR10
Match: AT4G36350.1 (AT4G36350.1 purple acid phosphatase 25) HSP 1 Score: 65.1 bits (157), Expect = 3.2e-11 Identity = 27/45 (60.00%), Postives = 31/45 (68.89%), Query Frame = 1
BLAST of MELO3C020445 vs. TAIR10
Match: AT2G18130.1 (AT2G18130.1 purple acid phosphatase 11) HSP 1 Score: 62.8 bits (151), Expect = 1.6e-10 Identity = 25/48 (52.08%), Postives = 34/48 (70.83%), Query Frame = 1
BLAST of MELO3C020445 vs. NCBI nr
Match: gi|659114810|ref|XP_008457239.1| (PREDICTED: purple acid phosphatase 15 isoform X4 [Cucumis melo]) HSP 1 Score: 252.3 bits (643), Expect = 4.1e-64 Identity = 113/113 (100.00%), Postives = 113/113 (100.00%), Query Frame = 1
BLAST of MELO3C020445 vs. NCBI nr
Match: gi|659114802|ref|XP_008457235.1| (PREDICTED: purple acid phosphatase 15 isoform X1 [Cucumis melo]) HSP 1 Score: 252.3 bits (643), Expect = 4.1e-64 Identity = 113/113 (100.00%), Postives = 113/113 (100.00%), Query Frame = 1
BLAST of MELO3C020445 vs. NCBI nr
Match: gi|449442385|ref|XP_004138962.1| (PREDICTED: purple acid phosphatase 15 [Cucumis sativus]) HSP 1 Score: 242.3 bits (617), Expect = 4.2e-61 Identity = 108/113 (95.58%), Postives = 111/113 (98.23%), Query Frame = 1
BLAST of MELO3C020445 vs. NCBI nr
Match: gi|659114808|ref|XP_008457238.1| (PREDICTED: purple acid phosphatase 15 isoform X3 [Cucumis melo]) HSP 1 Score: 227.3 bits (578), Expect = 1.4e-56 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 1
BLAST of MELO3C020445 vs. NCBI nr
Match: gi|659114806|ref|XP_008457237.1| (PREDICTED: purple acid phosphatase 15 isoform X2 [Cucumis melo]) HSP 1 Score: 226.1 bits (575), Expect = 3.1e-56 Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |