MELO3C020287 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTCTAGAACTGCTTTGCAAGCTGAATTACTTAGCAGACATGTTTTTCTGATGGAGTATTGTGAAGAAAGGCCTTTACTTTCGGGCAACATTGGAAAGGAGGCAAGGCTGTGCACTTATTATCAAGGCTGTGCACTTACTTTCTGGTGTGATGTTGCGGAATGGGGGGATAATTTAGGACATGTCGTTTTCCTTGAACCTTCAGATAAATCGCCTTTTCTTAGGAATTAA ATGGGTTCTAGAACTGCTTTGCAAGCTGAATTACTTAGCAGACATGTTTTTCTGATGGAGTATTGTGAAGAAAGGCCTTTACTTTCGGGCAACATTGGAAAGGAGGCAAGGCTGTGCACTTATTATCAAGGCTGTGCACTTACTTTCTGGTGTGATGTTGCGGAATGGGGGGATAATTTAGGACATGTCGTTTTCCTTGAACCTTCAGATAAATCGCCTTTTCTTAGGAATTAA ATGGGTTCTAGAACTGCTTTGCAAGCTGAATTACTTAGCAGACATGTTTTTCTGATGGAGTATTGTGAAGAAAGGCCTTTACTTTCGGGCAACATTGGAAAGGAGGCAAGGCTGTGCACTTATTATCAAGGCTGTGCACTTACTTTCTGGTGTGATGTTGCGGAATGGGGGGATAATTTAGGACATGTCGTTTTCCTTGAACCTTCAGATAAATCGCCTTTTCTTAGGAATTAA MGSRTALQAELLSRHVFLMEYCEERPLLSGNIGKEARLCTYYQGCALTFWCDVAEWGDNLGHVVFLEPSDKSPFLRN*
BLAST of MELO3C020287 vs. Swiss-Prot
Match: TAF1_ORYSJ (Transcription initiation factor TFIID subunit 1 OS=Oryza sativa subsp. japonica GN=TAF1 PE=2 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 3.6e-11 Identity = 35/65 (53.85%), Postives = 41/65 (63.08%), Query Frame = 1
BLAST of MELO3C020287 vs. Swiss-Prot
Match: TAF1_ARATH (Transcription initiation factor TFIID subunit 1 OS=Arabidopsis thaliana GN=TAF1 PE=1 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 7.9e-11 Identity = 35/63 (55.56%), Postives = 38/63 (60.32%), Query Frame = 1
BLAST of MELO3C020287 vs. Swiss-Prot
Match: TAF1B_ARATH (Transcription initiation factor TFIID subunit 1b OS=Arabidopsis thaliana GN=TAF1B PE=2 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.3e-09 Identity = 33/63 (52.38%), Postives = 36/63 (57.14%), Query Frame = 1
BLAST of MELO3C020287 vs. TrEMBL
Match: A0A0A0KA05_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G357030 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 3.8e-12 Identity = 40/62 (64.52%), Postives = 45/62 (72.58%), Query Frame = 1
BLAST of MELO3C020287 vs. TrEMBL
Match: A0A0S3T4H4_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.10G127100 PE=4 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.5e-11 Identity = 37/63 (58.73%), Postives = 44/63 (69.84%), Query Frame = 1
BLAST of MELO3C020287 vs. TrEMBL
Match: A0A0L9US62_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan06g073300 PE=4 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.5e-11 Identity = 37/63 (58.73%), Postives = 44/63 (69.84%), Query Frame = 1
BLAST of MELO3C020287 vs. TrEMBL
Match: V7CJ31_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_002G127400g PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 3.2e-11 Identity = 36/63 (57.14%), Postives = 44/63 (69.84%), Query Frame = 1
BLAST of MELO3C020287 vs. TrEMBL
Match: A0A151QTD8_CAJCA (Transcription initiation factor TFIID subunit 1-A OS=Cajanus cajan GN=KK1_045606 PE=4 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 7.2e-11 Identity = 36/63 (57.14%), Postives = 44/63 (69.84%), Query Frame = 1
BLAST of MELO3C020287 vs. TAIR10
Match: AT1G32750.1 (AT1G32750.1 HAC13 protein (HAC13)) HSP 1 Score: 67.4 bits (163), Expect = 4.5e-12 Identity = 35/63 (55.56%), Postives = 38/63 (60.32%), Query Frame = 1
BLAST of MELO3C020287 vs. TAIR10
Match: AT3G19040.1 (AT3G19040.1 histone acetyltransferase of the TAFII250 family 2) HSP 1 Score: 62.0 bits (149), Expect = 1.9e-10 Identity = 33/63 (52.38%), Postives = 36/63 (57.14%), Query Frame = 1
BLAST of MELO3C020287 vs. NCBI nr
Match: gi|659116422|ref|XP_008458065.1| (PREDICTED: transcription initiation factor TFIID subunit 1 isoform X1 [Cucumis melo]) HSP 1 Score: 79.3 bits (194), Expect = 3.2e-12 Identity = 40/63 (63.49%), Postives = 45/63 (71.43%), Query Frame = 1
BLAST of MELO3C020287 vs. NCBI nr
Match: gi|659116430|ref|XP_008458069.1| (PREDICTED: transcription initiation factor TFIID subunit 1 isoform X2 [Cucumis melo]) HSP 1 Score: 79.3 bits (194), Expect = 3.2e-12 Identity = 40/63 (63.49%), Postives = 45/63 (71.43%), Query Frame = 1
BLAST of MELO3C020287 vs. NCBI nr
Match: gi|778727071|ref|XP_011659205.1| (PREDICTED: transcription initiation factor TFIID subunit 1 [Cucumis sativus]) HSP 1 Score: 78.6 bits (192), Expect = 5.5e-12 Identity = 40/62 (64.52%), Postives = 45/62 (72.58%), Query Frame = 1
BLAST of MELO3C020287 vs. NCBI nr
Match: gi|1012124074|ref|XP_015963169.1| (PREDICTED: LOW QUALITY PROTEIN: transcription initiation factor TFIID subunit 1-like [Arachis duranensis]) HSP 1 Score: 76.6 bits (187), Expect = 2.1e-11 Identity = 37/63 (58.73%), Postives = 45/63 (71.43%), Query Frame = 1
BLAST of MELO3C020287 vs. NCBI nr
Match: gi|1021515583|ref|XP_016201251.1| (PREDICTED: transcription initiation factor TFIID subunit 1 isoform X1 [Arachis ipaensis]) HSP 1 Score: 76.6 bits (187), Expect = 2.1e-11 Identity = 37/63 (58.73%), Postives = 45/63 (71.43%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|