MELO3C020248 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAAAGGATGATCATATCGATGATGATTCTATCAACTACAACCACATTGAAGATGAAGATGATGATTCTATCGAATTCAATTGCATTGAAGATGAAAAAGATGATGATCCTCTCAACTGCGTCTCATTAAAGATGAATATGATGATCGTCTTGGTTGCACCATATTGAAGATGAGGATGATGATCGTCTCGACTGGTCGCATGTCTTTGCTGCACCACATTGAAGATGAAGATGATGATCGACCGCATTGAAGACGAAAATGAAGATGATCCTCTCGGCTGTAGCCGCATTGAAGACGAAGATAAAGATGATCCTCTCGACTGTGACGACATTGAAGACGAAGATGATAATCCTCTTGACTGTAACATATGGTAA ATGGAAAAGGATGATCATATCGATGATGATTCTATCAACTACAACCACATTGAAGATGAAGATGATGATTCTATCGAATTCAATTGCATTGAAGATGAAAAAGATGATGATCCTCTCAACTGCGTCTCATTAAAGATGAATATGATGATCGTCTTGATGAAGATGATGATCGACCGCATTGAAGACGAAAATGAAGATGATCCTCTCGGCTGTAGCCGCATTGAAGACGAAGATAAAGATGATCCTCTCGACTGTGACGACATTGAAGACGAAGATGATAATCCTCTTGACTGTAACATATGGTAA ATGGAAAAGGATGATCATATCGATGATGATTCTATCAACTACAACCACATTGAAGATGAAGATGATGATTCTATCGAATTCAATTGCATTGAAGATGAAAAAGATGATGATCCTCTCAACTGCGTCTCATTAAAGATGAATATGATGATCGTCTTGATGAAGATGATGATCGACCGCATTGAAGACGAAAATGAAGATGATCCTCTCGGCTGTAGCCGCATTGAAGACGAAGATAAAGATGATCCTCTCGACTGTGACGACATTGAAGACGAAGATGATAATCCTCTTGACTGTAACATATGGTAA MEKDDHIDDDSINYNHIEDEDDDSIEFNCIEDEKDDDPLNCVSLKMNMMIVLMKMMIDRIEDENEDDPLGCSRIEDEDKDDPLDCDDIEDEDDNPLDCNIW*
BLAST of MELO3C020248 vs. NCBI nr
Match: gi|659127358|ref|XP_008463661.1| (PREDICTED: prostatic spermine-binding protein-like [Cucumis melo]) HSP 1 Score: 94.4 bits (233), Expect = 1.3e-16 Identity = 48/98 (48.98%), Postives = 62/98 (63.27%), Query Frame = 1
BLAST of MELO3C020248 vs. NCBI nr
Match: gi|659127358|ref|XP_008463661.1| (PREDICTED: prostatic spermine-binding protein-like [Cucumis melo]) HSP 1 Score: 94.0 bits (232), Expect = 1.7e-16 Identity = 64/149 (42.95%), Postives = 79/149 (53.02%), Query Frame = 1
HSP 2 Score: 49.7 bits (117), Expect = 3.6e-03 Identity = 24/51 (47.06%), Postives = 38/51 (74.51%), Query Frame = 1
HSP 3 Score: 93.6 bits (231), Expect = 2.2e-16 Identity = 59/111 (53.15%), Postives = 69/111 (62.16%), Query Frame = 1
BLAST of MELO3C020248 vs. NCBI nr
Match: gi|659114284|ref|XP_008456992.1| (PREDICTED: prostatic spermine-binding protein-like [Cucumis melo]) HSP 1 Score: 79.7 bits (195), Expect = 3.2e-12 Identity = 49/98 (50.00%), Postives = 61/98 (62.24%), Query Frame = 1
HSP 2 Score: 75.9 bits (185), Expect = 4.7e-11 Identity = 53/144 (36.81%), Postives = 66/144 (45.83%), Query Frame = 1
HSP 3 Score: 82.8 bits (203), Expect = 3.8e-13 Identity = 54/133 (40.60%), Postives = 68/133 (51.13%), Query Frame = 1
BLAST of MELO3C020248 vs. NCBI nr
Match: gi|659083329|ref|XP_008442294.1| (PREDICTED: protein bfr2-like [Cucumis melo]) HSP 1 Score: 77.0 bits (188), Expect = 2.1e-11 Identity = 44/98 (44.90%), Postives = 61/98 (62.24%), Query Frame = 1
BLAST of MELO3C020248 vs. NCBI nr
Match: gi|659083329|ref|XP_008442294.1| (PREDICTED: protein bfr2-like [Cucumis melo]) HSP 1 Score: 75.9 bits (185), Expect = 4.7e-11 Identity = 41/86 (47.67%), Postives = 53/86 (61.63%), Query Frame = 1
HSP 2 Score: 75.5 bits (184), Expect = 6.1e-11 Identity = 42/97 (43.30%), Postives = 59/97 (60.82%), Query Frame = 1
HSP 3 Score: 73.6 bits (179), Expect = 2.3e-10 Identity = 47/111 (42.34%), Postives = 62/111 (55.86%), Query Frame = 1
HSP 4 Score: 71.2 bits (173), Expect = 1.1e-09 Identity = 45/106 (42.45%), Postives = 62/106 (58.49%), Query Frame = 1
HSP 5 Score: 70.9 bits (172), Expect = 1.5e-09 Identity = 45/98 (45.92%), Postives = 58/98 (59.18%), Query Frame = 1
HSP 6 Score: 69.7 bits (169), Expect = 3.3e-09 Identity = 48/115 (41.74%), Postives = 61/115 (53.04%), Query Frame = 1
HSP 7 Score: 62.8 bits (151), Expect = 4.1e-07 Identity = 39/101 (38.61%), Postives = 56/101 (55.45%), Query Frame = 1
HSP 8 Score: 62.8 bits (151), Expect = 4.1e-07 Identity = 37/83 (44.58%), Postives = 48/83 (57.83%), Query Frame = 1
HSP 9 Score: 62.4 bits (150), Expect = 5.3e-07 Identity = 44/118 (37.29%), Postives = 58/118 (49.15%), Query Frame = 1
HSP 10 Score: 62.0 bits (149), Expect = 7.0e-07 Identity = 44/106 (41.51%), Postives = 55/106 (51.89%), Query Frame = 1
HSP 11 Score: 59.7 bits (143), Expect = 3.4e-06 Identity = 47/111 (42.34%), Postives = 58/111 (52.25%), Query Frame = 1
HSP 12 Score: 55.8 bits (133), Expect = 5.0e-05 Identity = 42/132 (31.82%), Postives = 59/132 (44.70%), Query Frame = 1
HSP 13 Score: 44.7 bits (104), Expect = 1.1e-01 Identity = 23/51 (45.10%), Postives = 32/51 (62.75%), Query Frame = 1
HSP 14 Score: 59.7 bits (143), Expect = 3.4e-06 Identity = 33/92 (35.87%), Postives = 51/92 (55.43%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|