MELO3C020213 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGGCGAGCATCTGGAATAACTAATGAATTACAACTCTATTGTACCGCAATTGGTGCATTAGTCTTTGCAGCCTTAATGCTTTTTGCTGGTTGGTTTCATTATCACAAGGCTGCTCCAAAATTGGCTTGGTTCCAAAATGTAGAATCCATGTTGAATCACCATTTAACGGGTCTCCAGTAA ATGTGGCGAGCATCTGGAATAACTAATGAATTACAACTCTATTGTACCGCAATTGGTGCATTAGTCTTTGCAGCCTTAATGCTTTTTGCTGGTTGGTTTCATTATCACAAGGCTGCTCCAAAATTGGCTTGGTTCCAAAATGTAGAATCCATGTTGAATCACCATTTAACGGGTCTCCAGTAA ATGTGGCGAGCATCTGGAATAACTAATGAATTACAACTCTATTGTACCGCAATTGGTGCATTAGTCTTTGCAGCCTTAATGCTTTTTGCTGGTTGGTTTCATTATCACAAGGCTGCTCCAAAATTGGCTTGGTTCCAAAATGTAGAATCCATGTTGAATCACCATTTAACGGGTCTCCAGTAA MWRASGITNELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLAWFQNVESMLNHHLTGLQ*
BLAST of MELO3C020213 vs. Swiss-Prot
Match: PSAA_PHAVU (Photosystem I P700 chlorophyll a apoprotein A1 OS=Phaseolus vulgaris GN=psaA PE=3 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 2.5e-28 Identity = 57/59 (96.61%), Postives = 57/59 (96.61%), Query Frame = 1
BLAST of MELO3C020213 vs. Swiss-Prot
Match: PSAA_CUCSA (Photosystem I P700 chlorophyll a apoprotein A1 OS=Cucumis sativus GN=psaA PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 3.3e-28 Identity = 57/59 (96.61%), Postives = 56/59 (94.92%), Query Frame = 1
BLAST of MELO3C020213 vs. Swiss-Prot
Match: PSAA_VITVI (Photosystem I P700 chlorophyll a apoprotein A1 OS=Vitis vinifera GN=psaA PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 3.3e-28 Identity = 57/59 (96.61%), Postives = 56/59 (94.92%), Query Frame = 1
BLAST of MELO3C020213 vs. Swiss-Prot
Match: PSAA_CALFG (Photosystem I P700 chlorophyll a apoprotein A1 OS=Calycanthus floridus var. glaucus GN=psaA PE=3 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 7.3e-28 Identity = 56/59 (94.92%), Postives = 56/59 (94.92%), Query Frame = 1
BLAST of MELO3C020213 vs. Swiss-Prot
Match: PSAA_SOYBN (Photosystem I P700 chlorophyll a apoprotein A1 OS=Glycine max GN=psaA PE=3 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 9.5e-28 Identity = 56/59 (94.92%), Postives = 57/59 (96.61%), Query Frame = 1
BLAST of MELO3C020213 vs. TrEMBL
Match: G3ETY5_CUCME (Photosystem I P700 chlorophyll a apoprotein A1 OS=Cucumis melo subsp. melo GN=psaA PE=3 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 9.6e-27 Identity = 58/59 (98.31%), Postives = 58/59 (98.31%), Query Frame = 1
BLAST of MELO3C020213 vs. TrEMBL
Match: G3EU42_CUCME (Putative uncharacterized protein ORF4 OS=Cucumis melo subsp. melo GN=ORF4 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 9.6e-27 Identity = 58/59 (98.31%), Postives = 58/59 (98.31%), Query Frame = 1
BLAST of MELO3C020213 vs. TrEMBL
Match: H6SZA1_9LILI (Photosystem I P700 apoprotein A1 (Fragment) OS=Belosynapsis ciliata GN=psaA PE=3 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 2.8e-26 Identity = 57/59 (96.61%), Postives = 58/59 (98.31%), Query Frame = 1
BLAST of MELO3C020213 vs. TrEMBL
Match: A0A0K0LUX6_9FABA (Photosystem I P700 chlorophyll a apoprotein A1 OS=Strophostyles leiosperma GN=psaA PE=3 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 2.8e-26 Identity = 57/59 (96.61%), Postives = 59/59 (100.00%), Query Frame = 1
BLAST of MELO3C020213 vs. TrEMBL
Match: H6SZD4_TRAOH (Photosystem I P700 apoprotein A1 (Fragment) OS=Tradescantia ohiensis GN=psaA PE=3 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 2.8e-26 Identity = 57/59 (96.61%), Postives = 58/59 (98.31%), Query Frame = 1
BLAST of MELO3C020213 vs. TAIR10
Match: ATCG00350.1 (ATCG00350.1 Photosystem I, PsaA/PsaB protein) HSP 1 Score: 121.3 bits (303), Expect = 2.0e-28 Identity = 55/59 (93.22%), Postives = 56/59 (94.92%), Query Frame = 1
BLAST of MELO3C020213 vs. TAIR10
Match: ATCG00340.1 (ATCG00340.1 Photosystem I, PsaA/PsaB protein) HSP 1 Score: 55.8 bits (133), Expect = 1.1e-08 Identity = 26/59 (44.07%), Postives = 32/59 (54.24%), Query Frame = 1
BLAST of MELO3C020213 vs. NCBI nr
Match: gi|346578191|ref|YP_004841783.1| (photosystem I P700 apoprotein A1 [Cucumis melo subsp. melo]) HSP 1 Score: 126.7 bits (317), Expect = 1.4e-26 Identity = 58/59 (98.31%), Postives = 58/59 (98.31%), Query Frame = 1
BLAST of MELO3C020213 vs. NCBI nr
Match: gi|345034447|gb|AEN56132.1| (hypothetical protein [Cucumis melo subsp. melo]) HSP 1 Score: 126.7 bits (317), Expect = 1.4e-26 Identity = 58/59 (98.31%), Postives = 58/59 (98.31%), Query Frame = 1
BLAST of MELO3C020213 vs. NCBI nr
Match: gi|289066818|ref|YP_003434336.1| (photosystem I P700 apoprotein A1 [Vigna radiata]) HSP 1 Score: 125.2 bits (313), Expect = 4.0e-26 Identity = 57/59 (96.61%), Postives = 59/59 (100.00%), Query Frame = 1
BLAST of MELO3C020213 vs. NCBI nr
Match: gi|139387444|ref|YP_001122798.1| (photosystem I P700 apoprotein A1 [Phaseolus vulgaris]) HSP 1 Score: 125.2 bits (313), Expect = 4.0e-26 Identity = 57/59 (96.61%), Postives = 59/59 (100.00%), Query Frame = 1
BLAST of MELO3C020213 vs. NCBI nr
Match: gi|1012321961|gb|KYP34360.1| (Photosystem I P700 chlorophyll a apoprotein A1 family [Cajanus cajan]) HSP 1 Score: 125.2 bits (313), Expect = 4.0e-26 Identity = 57/59 (96.61%), Postives = 59/59 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |