MELO3C020066 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTCCTTACAGACTGTTGCGGAGCTACTTCATTGTATGCCAGATGTAGCCTACTTTGCAAAGCTGATGACTGGTGGAATTATTTCGTTATCTGCTACATTAGCTTCAAACTTTGTATTTGAATCCTTTATTGGTGACTCTAAGGTATTTGAATCCTTACAATTTTTGGCATCCACCAAGTGGTTAAATACCTGTTTTCACGTTATTTTTATAACTTGAGGCCCTTTTGCATGGACACTCGTATTTTGCTCATGCTTTGGGCTGCACCGTTGCTGCAAAGTCCATTAAATGGTTTAAAGATCCTCAAACAAACCTGAATATAATTTCTGAAGGGACATCTCTCAGGGAGGTATGTGCGATCTATTTAAAGTTGTTCTTAAGTGGCTGGTAA ATGGGTTCCTTACAGACTGTTGCGGAGCTACTTCATTGTATGCCAGATGTAGCCTACTTTGCAAAGCTGATGACTGGTGGAATTATTTCGTTATCTGCTACATTAGCTTCAAACTTTGTATTTGAATCCTTTATTGGTGACTCTAAGGCCCTTTTGCATGGACACTCGTATTTTGCTCATGCTTTGGGCTGCACCGTTGCTGCAAAGTCCATTAAATGGTTTAAAGATCCTCAAACAAACCTGAATATAATTTCTGAAGGGACATCTCTCAGGGAGGTATGTGCGATCTATTTAAAGTTGTTCTTAAGTGGCTGGTAA ATGGGTTCCTTACAGACTGTTGCGGAGCTACTTCATTGTATGCCAGATGTAGCCTACTTTGCAAAGCTGATGACTGGTGGAATTATTTCGTTATCTGCTACATTAGCTTCAAACTTTGTATTTGAATCCTTTATTGGTGACTCTAAGGCCCTTTTGCATGGACACTCGTATTTTGCTCATGCTTTGGGCTGCACCGTTGCTGCAAAGTCCATTAAATGGTTTAAAGATCCTCAAACAAACCTGAATATAATTTCTGAAGGGACATCTCTCAGGGAGGTATGTGCGATCTATTTAAAGTTGTTCTTAAGTGGCTGGTAA MGSLQTVAELLHCMPDVAYFAKLMTGGIISLSATLASNFVFESFIGDSKALLHGHSYFAHALGCTVAAKSIKWFKDPQTNLNIISEGTSLREVCAIYLKLFLSGW*
BLAST of MELO3C020066 vs. Swiss-Prot
Match: BIODA_ARATH (Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial OS=Arabidopsis thaliana GN=BIO3-BIO1 PE=1 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 1.7e-27 Identity = 58/92 (63.04%), Postives = 73/92 (79.35%), Query Frame = 1
BLAST of MELO3C020066 vs. Swiss-Prot
Match: BIODA_ORYSJ (Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial OS=Oryza sativa subsp. japonica GN=BIO3-BIO1 PE=2 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.2e-23 Identity = 51/92 (55.43%), Postives = 68/92 (73.91%), Query Frame = 1
BLAST of MELO3C020066 vs. Swiss-Prot
Match: BIOA_ANOFW (Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=bioA PE=3 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.9e-07 Identity = 31/89 (34.83%), Postives = 47/89 (52.81%), Query Frame = 1
BLAST of MELO3C020066 vs. Swiss-Prot
Match: BIOA_STAA8 (Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=bioA PE=3 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 3.6e-06 Identity = 25/81 (30.86%), Postives = 45/81 (55.56%), Query Frame = 1
BLAST of MELO3C020066 vs. Swiss-Prot
Match: BIOA_AQUAE (Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=bioA PE=3 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 4.7e-06 Identity = 25/68 (36.76%), Postives = 42/68 (61.76%), Query Frame = 1
BLAST of MELO3C020066 vs. TrEMBL
Match: A0A0A0LUH6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G421880 PE=3 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 7.0e-33 Identity = 75/91 (82.42%), Postives = 81/91 (89.01%), Query Frame = 1
BLAST of MELO3C020066 vs. TrEMBL
Match: W9S907_9ROSA (Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Morus notabilis GN=L484_022897 PE=4 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 1.9e-30 Identity = 69/91 (75.82%), Postives = 79/91 (86.81%), Query Frame = 1
BLAST of MELO3C020066 vs. TrEMBL
Match: V4UQS8_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10007423mg PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 2.0e-27 Identity = 63/92 (68.48%), Postives = 76/92 (82.61%), Query Frame = 1
BLAST of MELO3C020066 vs. TrEMBL
Match: A0A067F4Y7_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0029411mg PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 2.0e-27 Identity = 63/92 (68.48%), Postives = 76/92 (82.61%), Query Frame = 1
BLAST of MELO3C020066 vs. TrEMBL
Match: A0A067FGY5_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0029411mg PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 2.0e-27 Identity = 63/92 (68.48%), Postives = 76/92 (82.61%), Query Frame = 1
BLAST of MELO3C020066 vs. TAIR10
Match: AT5G57590.1 (AT5G57590.1 adenosylmethionine-8-amino-7-oxononanoate transaminases) HSP 1 Score: 123.2 bits (308), Expect = 9.3e-29 Identity = 58/92 (63.04%), Postives = 73/92 (79.35%), Query Frame = 1
BLAST of MELO3C020066 vs. NCBI nr
Match: gi|659107355|ref|XP_008453633.1| (PREDICTED: bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial isoform X1 [Cucumis melo]) HSP 1 Score: 156.0 bits (393), Expect = 3.7e-35 Identity = 80/98 (81.63%), Postives = 85/98 (86.73%), Query Frame = 1
BLAST of MELO3C020066 vs. NCBI nr
Match: gi|659107357|ref|XP_008453634.1| (PREDICTED: bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial isoform X2 [Cucumis melo]) HSP 1 Score: 152.1 bits (383), Expect = 5.3e-34 Identity = 77/91 (84.62%), Postives = 82/91 (90.11%), Query Frame = 1
BLAST of MELO3C020066 vs. NCBI nr
Match: gi|778660685|ref|XP_011656711.1| (PREDICTED: bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial [Cucumis sativus]) HSP 1 Score: 147.9 bits (372), Expect = 1.0e-32 Identity = 75/91 (82.42%), Postives = 81/91 (89.01%), Query Frame = 1
BLAST of MELO3C020066 vs. NCBI nr
Match: gi|659082992|ref|XP_008442133.1| (PREDICTED: bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial-like isoform X2 [Cucumis melo]) HSP 1 Score: 145.6 bits (366), Expect = 5.0e-32 Identity = 76/103 (73.79%), Postives = 81/103 (78.64%), Query Frame = 1
BLAST of MELO3C020066 vs. NCBI nr
Match: gi|659082986|ref|XP_008442130.1| (PREDICTED: bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial-like isoform X1 [Cucumis melo]) HSP 1 Score: 145.6 bits (366), Expect = 5.0e-32 Identity = 76/103 (73.79%), Postives = 81/103 (78.64%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|