MELO3C019448 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGCAGCAATTTTCATCCGCTCACATACTTGAAGTCTACAGGGGTTCCTTAAGCCAATTTGTGGGTCATGATATAAACTTGTGTTTTTTCTGTTAGCTTCAAGTTGGGTATTTATTCTAATTGCCTTTTATTGACAAATCTAGGTGAAAAAACACAGACATGAAAAGTTGAGTCTGCATGGTGCTGGAAAACATCTTTTGAAAAGTGATGCTTCTCGCATATTGCACTATCTTGTTATTGAGGATATCCTCGTGGAAGAAGTGAAGAAAAATGATATTTATGGATCTGTTTCATCCCTACTGAAGGTGGTAAACCAATTGCTTCTTCCTTTATGCTAA ATGGGGCAGCAATTTTCATCCGCTCACATACTTGAAGTCTACAGGGGTTCCTTAAGCCAATTTGTGAAAAAACACAGACATGAAAAGTTGAGTCTGCATGGTGCTGGAAAACATCTTTTGAAAAGTGATGCTTCTCGCATATTGCACTATCTTGTTATTGAGGATATCCTCGTGGAAGAAGTGAAGAAAAATGATATTTATGGATCTGTTTCATCCCTACTGAAGGTGGTAAACCAATTGCTTCTTCCTTTATGCTAA ATGGGGCAGCAATTTTCATCCGCTCACATACTTGAAGTCTACAGGGGTTCCTTAAGCCAATTTGTGAAAAAACACAGACATGAAAAGTTGAGTCTGCATGGTGCTGGAAAACATCTTTTGAAAAGTGATGCTTCTCGCATATTGCACTATCTTGTTATTGAGGATATCCTCGTGGAAGAAGTGAAGAAAAATGATATTTATGGATCTGTTTCATCCCTACTGAAGGTGGTAAACCAATTGCTTCTTCCTTTATGCTAA MGQQFSSAHILEVYRGSLSQFVKKHRHEKLSLHGAGKHLLKSDASRILHYLVIEDILVEEVKKNDIYGSVSSLLKVVNQLLLPLC*
BLAST of MELO3C019448 vs. Swiss-Prot
Match: RQL4A_ARATH (ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana GN=RECQL4A PE=2 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 3.9e-27 Identity = 59/77 (76.62%), Postives = 66/77 (85.71%), Query Frame = 1
BLAST of MELO3C019448 vs. Swiss-Prot
Match: RQL4B_ARATH (ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana GN=RECQL4B PE=2 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 8.1e-25 Identity = 55/75 (73.33%), Postives = 65/75 (86.67%), Query Frame = 1
BLAST of MELO3C019448 vs. TrEMBL
Match: A0A0A0L762_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G221760 PE=4 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 2.4e-31 Identity = 71/76 (93.42%), Postives = 75/76 (98.68%), Query Frame = 1
BLAST of MELO3C019448 vs. TrEMBL
Match: A0A061E184_THECC (DNA helicase isoform 1 OS=Theobroma cacao GN=TCM_006933 PE=4 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 3.6e-27 Identity = 64/84 (76.19%), Postives = 73/84 (86.90%), Query Frame = 1
BLAST of MELO3C019448 vs. TrEMBL
Match: A0A022QCX5_ERYGU (Uncharacterized protein OS=Erythranthe guttata GN=MIMGU_mgv1a000354mg PE=4 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 3.6e-27 Identity = 61/75 (81.33%), Postives = 71/75 (94.67%), Query Frame = 1
BLAST of MELO3C019448 vs. TrEMBL
Match: A0A061E0C7_THECC (DNA helicase (RECQl4A) isoform 2 OS=Theobroma cacao GN=TCM_006933 PE=4 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 3.6e-27 Identity = 64/84 (76.19%), Postives = 73/84 (86.90%), Query Frame = 1
BLAST of MELO3C019448 vs. TrEMBL
Match: V4SBW7_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10000077mg PE=4 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 6.1e-27 Identity = 62/75 (82.67%), Postives = 71/75 (94.67%), Query Frame = 1
BLAST of MELO3C019448 vs. TAIR10
Match: AT1G10930.1 (AT1G10930.1 DNA helicase (RECQl4A)) HSP 1 Score: 121.7 bits (304), Expect = 2.2e-28 Identity = 59/77 (76.62%), Postives = 66/77 (85.71%), Query Frame = 1
BLAST of MELO3C019448 vs. TAIR10
Match: AT1G60930.1 (AT1G60930.1 RECQ helicase L4B) HSP 1 Score: 114.0 bits (284), Expect = 4.6e-26 Identity = 55/75 (73.33%), Postives = 65/75 (86.67%), Query Frame = 1
BLAST of MELO3C019448 vs. NCBI nr
Match: gi|659112082|ref|XP_008456057.1| (PREDICTED: ATP-dependent DNA helicase Q-like 4A isoform X1 [Cucumis melo]) HSP 1 Score: 150.6 bits (379), Expect = 1.3e-33 Identity = 76/76 (100.00%), Postives = 76/76 (100.00%), Query Frame = 1
BLAST of MELO3C019448 vs. NCBI nr
Match: gi|659112086|ref|XP_008456059.1| (PREDICTED: ATP-dependent DNA helicase Q-like 4A isoform X2 [Cucumis melo]) HSP 1 Score: 150.6 bits (379), Expect = 1.3e-33 Identity = 76/76 (100.00%), Postives = 76/76 (100.00%), Query Frame = 1
BLAST of MELO3C019448 vs. NCBI nr
Match: gi|659112088|ref|XP_008456060.1| (PREDICTED: ATP-dependent DNA helicase Q-like 4A isoform X3 [Cucumis melo]) HSP 1 Score: 150.6 bits (379), Expect = 1.3e-33 Identity = 76/76 (100.00%), Postives = 76/76 (100.00%), Query Frame = 1
BLAST of MELO3C019448 vs. NCBI nr
Match: gi|659112090|ref|XP_008456061.1| (PREDICTED: ATP-dependent DNA helicase Q-like 4A isoform X4 [Cucumis melo]) HSP 1 Score: 150.6 bits (379), Expect = 1.3e-33 Identity = 76/76 (100.00%), Postives = 76/76 (100.00%), Query Frame = 1
BLAST of MELO3C019448 vs. NCBI nr
Match: gi|659112092|ref|XP_008456062.1| (PREDICTED: ATP-dependent DNA helicase Q-like 4A isoform X5 [Cucumis melo]) HSP 1 Score: 150.6 bits (379), Expect = 1.3e-33 Identity = 76/76 (100.00%), Postives = 76/76 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|