MELO3C019419 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTACAATTTATGTCATCTTCTTTATGCCTTTGTACTATTTCATTCTTTCTTAGCGCAAGTGGTTTTTCATAGATAATGGTTAAAATGAATACAGGGTGATCCACTAAAGATTCCCAAGGCTGTTCTTCATCAATTATGTCAGAAAGAAGGATGGGATGCACCAAAATTTAATAAAATCCACAGAAAAGAAAATGGTTTTTTCTATGCTGTCAGTGTGCTGCGTAAAGCAAGTGGGAGAGGTAAAAATCGGAAAGCTGGAGGTCTTATCACTCTTCAGTTTCCCAATGAGGATGAAATTTTTGAATCTGCAGAGGTACTTTGA ATGGGTGATCCACTAAAGATTCCCAAGGCTGTTCTTCATCAATTATGTCAGAAAGAAGGATGGGATGCACCAAAATTTAATAAAATCCACAGAAAAGAAAATGGTTTTTTCTATGCTGTCAGTGTGCTGCGTAAAGCAAGTGGGAGAGGTAAAAATCGGAAAGCTGGAGGTCTTATCACTCTTCAGTTTCCCAATGAGGATGAAATTTTTGAATCTGCAGAGGTACTTTGA ATGGGTGATCCACTAAAGATTCCCAAGGCTGTTCTTCATCAATTATGTCAGAAAGAAGGATGGGATGCACCAAAATTTAATAAAATCCACAGAAAAGAAAATGGTTTTTTCTATGCTGTCAGTGTGCTGCGTAAAGCAAGTGGGAGAGGTAAAAATCGGAAAGCTGGAGGTCTTATCACTCTTCAGTTTCCCAATGAGGATGAAATTTTTGAATCTGCAGAGGTACTTTGA MGDPLKIPKAVLHQLCQKEGWDAPKFNKIHRKENGFFYAVSVLRKASGRGKNRKAGGLITLQFPNEDEIFESAEVL*
BLAST of MELO3C019419 vs. Swiss-Prot
Match: DEXH7_ARATH (DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 7.5e-22 Identity = 49/73 (67.12%), Postives = 56/73 (76.71%), Query Frame = 1
BLAST of MELO3C019419 vs. Swiss-Prot
Match: DEXH4_ARATH (DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.3e-18 Identity = 42/73 (57.53%), Postives = 54/73 (73.97%), Query Frame = 1
BLAST of MELO3C019419 vs. TrEMBL
Match: B9SSN0_RICCO (ATP-dependent RNA helicase, putative OS=Ricinus communis GN=RCOM_1374260 PE=4 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 1.3e-25 Identity = 55/73 (75.34%), Postives = 64/73 (87.67%), Query Frame = 1
BLAST of MELO3C019419 vs. TrEMBL
Match: A0A067E9B9_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0465321mg PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 3.9e-25 Identity = 58/75 (77.33%), Postives = 63/75 (84.00%), Query Frame = 1
BLAST of MELO3C019419 vs. TrEMBL
Match: U5GH39_POPTR (Uncharacterized protein (Fragment) OS=Populus trichocarpa GN=POPTR_0004s231601g PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 3.9e-25 Identity = 56/73 (76.71%), Postives = 65/73 (89.04%), Query Frame = 1
BLAST of MELO3C019419 vs. TrEMBL
Match: A0A067L1X0_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_00219 PE=4 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 5.1e-25 Identity = 56/73 (76.71%), Postives = 63/73 (86.30%), Query Frame = 1
BLAST of MELO3C019419 vs. TrEMBL
Match: V4T5X0_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v100000301mg PE=4 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 3.3e-24 Identity = 56/73 (76.71%), Postives = 61/73 (83.56%), Query Frame = 1
BLAST of MELO3C019419 vs. TAIR10
Match: AT1G58060.1 (AT1G58060.1 RNA helicase family protein) HSP 1 Score: 104.0 bits (258), Expect = 4.2e-23 Identity = 49/73 (67.12%), Postives = 56/73 (76.71%), Query Frame = 1
BLAST of MELO3C019419 vs. TAIR10
Match: AT1G58050.1 (AT1G58050.1 RNA helicase family protein) HSP 1 Score: 93.2 bits (230), Expect = 7.5e-20 Identity = 42/73 (57.53%), Postives = 54/73 (73.97%), Query Frame = 1
BLAST of MELO3C019419 vs. NCBI nr
Match: gi|659112040|ref|XP_008456036.1| (PREDICTED: ATP-dependent RNA helicase DHX29 isoform X1 [Cucumis melo]) HSP 1 Score: 154.1 bits (388), Expect = 1.0e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 1
BLAST of MELO3C019419 vs. NCBI nr
Match: gi|659112042|ref|XP_008456037.1| (PREDICTED: ATP-dependent RNA helicase DHX36 isoform X2 [Cucumis melo]) HSP 1 Score: 154.1 bits (388), Expect = 1.0e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 1
BLAST of MELO3C019419 vs. NCBI nr
Match: gi|778680315|ref|XP_011651288.1| (PREDICTED: ATP-dependent RNA helicase DHX36 isoform X2 [Cucumis sativus]) HSP 1 Score: 151.0 bits (380), Expect = 8.6e-34 Identity = 72/73 (98.63%), Postives = 72/73 (98.63%), Query Frame = 1
BLAST of MELO3C019419 vs. NCBI nr
Match: gi|778680313|ref|XP_011651287.1| (PREDICTED: ATP-dependent RNA helicase DHX29 isoform X1 [Cucumis sativus]) HSP 1 Score: 151.0 bits (380), Expect = 8.6e-34 Identity = 72/73 (98.63%), Postives = 72/73 (98.63%), Query Frame = 1
BLAST of MELO3C019419 vs. NCBI nr
Match: gi|1000946951|ref|XP_015580753.1| (PREDICTED: DExH-box ATP-dependent RNA helicase DExH7, chloroplastic isoform X2 [Ricinus communis]) HSP 1 Score: 123.2 bits (308), Expect = 1.9e-25 Identity = 55/73 (75.34%), Postives = 64/73 (87.67%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|