MELO3C019415.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGATGTTTTTAATTCTCCCAATGTTATGGATTTGAATCCTAAGATTTTGAGATTGACTTTTAAGGTTGTGTATGTTTGGGGTTGTTTCCCTTTTCAATTGGGTTTGAACTTCCCATTCAGACTCTCACCCATTTGGTTCTTTTGAGTATTTTTGCTGATATTGTTGACCTTAGAGCTATGGTGGTGGTGATTGTTAAAGATTTTTTGATTATCTTCAAGCAAAGCCCATATGCGGAGGCTTTTGGGTGATTTTTGTGTTCTTTTATGGAAAGGGTATGGCTGTTTATGCCTTTCAAGGTATTGGGATGATGTTGCCTCTAGAATTTAAGACAAAGGACAAAGAGAAATTTGGGAGAGTCATGGGTTTTTCCATGGATTTCATTACTGTTTTATATGGAGCATTTGAAACTCTTTGCTATTTTGCTTTTGGCAAAAATACTAAAGACTTGATCACTAGTAACTTGGGCCTTGGATTTATTAGCAATATTATTAAGTTAGATTATGTATAA ATGGATGATGTTTTTAATTCTCCCAATGTTATGGATTTGAATCCTAAGATTTTGAGATTGACTTTTAAGGTTGTGTATGTTTGGGGTTGTTTCCCTTTTCAATTGGCAAAGCCCATATGCGGAGGCTTTTGGGTGATTTTTGTGTTCTTTTATGGAAAGGGTATGGCTGTTTATGCCTTTCAAGGTATTGGGATGATGTTGCCTCTAGAATTTAAGACAAAGGACAAAGAGAAATTTGGGAGAGTCATGGGTTTTTCCATGGATTTCATTACTGTTTTATATGGAGCATTTGAAACTCTTTGCTATTTTGCTTTTGGCAAAAATACTAAAGACTTGATCACTAGTAACTTGGGCCTTGGATTTATTAGCAATATTATTAAGTTAGATTATGTATAA ATGGATGATGTTTTTAATTCTCCCAATGTTATGGATTTGAATCCTAAGATTTTGAGATTGACTTTTAAGGTTGTGTATGTTTGGGGTTGTTTCCCTTTTCAATTGGCAAAGCCCATATGCGGAGGCTTTTGGGTGATTTTTGTGTTCTTTTATGGAAAGGGTATGGCTGTTTATGCCTTTCAAGGTATTGGGATGATGTTGCCTCTAGAATTTAAGACAAAGGACAAAGAGAAATTTGGGAGAGTCATGGGTTTTTCCATGGATTTCATTACTGTTTTATATGGAGCATTTGAAACTCTTTGCTATTTTGCTTTTGGCAAAAATACTAAAGACTTGATCACTAGTAACTTGGGCCTTGGATTTATTAGCAATATTATTAAGTTAGATTATGTATAA MDDVFNSPNVMDLNPKILRLTFKVVYVWGCFPFQLAKPICGGFWVIFVFFYGKGMAVYAFQGIGMMLPLEFKTKDKEKFGRVMGFSMDFITVLYGAFETLCYFAFGKNTKDLITSNLGLGFISNIIKLDYV
BLAST of MELO3C019415.2 vs. NCBI nr
Match: XP_004139971.1 (PREDICTED: proton-coupled amino acid transporter 3-like [Cucumis sativus] >KGN46656.1 hypothetical protein Csa_6G118340 [Cucumis sativus]) HSP 1 Score: 172.6 bits (436), Expect = 9.1e-40 Identity = 95/167 (56.89%), Postives = 104/167 (62.28%), Query Frame = 0
BLAST of MELO3C019415.2 vs. NCBI nr
Match: XP_008448189.1 (PREDICTED: amino acid transporter ANTL1-like [Cucumis melo]) HSP 1 Score: 170.2 bits (430), Expect = 4.5e-39 Identity = 97/170 (57.06%), Postives = 107/170 (62.94%), Query Frame = 0
BLAST of MELO3C019415.2 vs. NCBI nr
Match: XP_022140690.1 (amino acid transporter AVT3B-like [Momordica charantia]) HSP 1 Score: 157.1 bits (396), Expect = 4.0e-35 Identity = 87/167 (52.10%), Postives = 99/167 (59.28%), Query Frame = 0
BLAST of MELO3C019415.2 vs. NCBI nr
Match: XP_022947382.1 (amino acid transporter AVT3B-like [Cucurbita moschata]) HSP 1 Score: 156.8 bits (395), Expect = 5.2e-35 Identity = 88/167 (52.69%), Postives = 99/167 (59.28%), Query Frame = 0
BLAST of MELO3C019415.2 vs. NCBI nr
Match: XP_022971020.1 (amino acid transporter AVT3B-like [Cucurbita maxima]) HSP 1 Score: 156.8 bits (395), Expect = 5.2e-35 Identity = 88/167 (52.69%), Postives = 99/167 (59.28%), Query Frame = 0
BLAST of MELO3C019415.2 vs. TAIR10
Match: AT2G42005.1 (Transmembrane amino acid transporter family protein) HSP 1 Score: 115.5 bits (288), Expect = 2.4e-26 Identity = 61/145 (42.07%), Postives = 83/145 (57.24%), Query Frame = 0
BLAST of MELO3C019415.2 vs. TAIR10
Match: AT5G65990.1 (Transmembrane amino acid transporter family protein) HSP 1 Score: 112.8 bits (281), Expect = 1.6e-25 Identity = 61/151 (40.40%), Postives = 83/151 (54.97%), Query Frame = 0
BLAST of MELO3C019415.2 vs. TAIR10
Match: AT4G38250.1 (Transmembrane amino acid transporter family protein) HSP 1 Score: 108.2 bits (269), Expect = 3.8e-24 Identity = 57/155 (36.77%), Postives = 85/155 (54.84%), Query Frame = 0
BLAST of MELO3C019415.2 vs. TAIR10
Match: AT3G11900.1 (aromatic and neutral transporter 1) HSP 1 Score: 51.6 bits (122), Expect = 4.3e-07 Identity = 25/67 (37.31%), Postives = 39/67 (58.21%), Query Frame = 0
BLAST of MELO3C019415.2 vs. Swiss-Prot
Match: sp|F4ILY9|AVT3B_ARATH (Amino acid transporter AVT3B OS=Arabidopsis thaliana OX=3702 GN=AVT3B PE=2 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 4.3e-25 Identity = 61/145 (42.07%), Postives = 83/145 (57.24%), Query Frame = 0
BLAST of MELO3C019415.2 vs. Swiss-Prot
Match: sp|Q9FKY3|AVT3A_ARATH (Amino acid transporter AVT3A OS=Arabidopsis thaliana OX=3702 GN=AVT3A PE=1 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 2.8e-24 Identity = 61/151 (40.40%), Postives = 83/151 (54.97%), Query Frame = 0
BLAST of MELO3C019415.2 vs. Swiss-Prot
Match: sp|Q9SVG0|AVT3C_ARATH (Amino acid transporter AVT3C OS=Arabidopsis thaliana OX=3702 GN=AVT3C PE=1 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 6.9e-23 Identity = 57/155 (36.77%), Postives = 85/155 (54.84%), Query Frame = 0
BLAST of MELO3C019415.2 vs. Swiss-Prot
Match: sp|Q8K4D3|S36A1_MOUSE (Proton-coupled amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc36a1 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.9e-10 Identity = 37/87 (42.53%), Postives = 52/87 (59.77%), Query Frame = 0
BLAST of MELO3C019415.2 vs. Swiss-Prot
Match: sp|Q924A5|S36A1_RAT (Proton-coupled amino acid transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc36a1 PE=2 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.5e-09 Identity = 36/87 (41.38%), Postives = 52/87 (59.77%), Query Frame = 0
BLAST of MELO3C019415.2 vs. TrEMBL
Match: tr|A0A0A0KFY3|A0A0A0KFY3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G118340 PE=4 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 6.0e-40 Identity = 95/167 (56.89%), Postives = 104/167 (62.28%), Query Frame = 0
BLAST of MELO3C019415.2 vs. TrEMBL
Match: tr|A0A1S3BJZ8|A0A1S3BJZ8_CUCME (amino acid transporter ANTL1-like OS=Cucumis melo OX=3656 GN=LOC103490455 PE=4 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 3.0e-39 Identity = 97/170 (57.06%), Postives = 107/170 (62.94%), Query Frame = 0
BLAST of MELO3C019415.2 vs. TrEMBL
Match: tr|A0A2C9V1H3|A0A2C9V1H3_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_11G110100 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 2.0e-27 Identity = 69/165 (41.82%), Postives = 96/165 (58.18%), Query Frame = 0
BLAST of MELO3C019415.2 vs. TrEMBL
Match: tr|K4BAC1|K4BAC1_SOLLC (Uncharacterized protein OS=Solanum lycopersicum OX=4081 GN=101261384 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 7.6e-27 Identity = 67/154 (43.51%), Postives = 92/154 (59.74%), Query Frame = 0
BLAST of MELO3C019415.2 vs. TrEMBL
Match: tr|M1DBC3|M1DBC3_SOLTU (Uncharacterized protein OS=Solanum tuberosum OX=4113 GN=102601768 PE=4 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 1.7e-26 Identity = 66/154 (42.86%), Postives = 92/154 (59.74%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|