MELO3C019311 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTGTGGAAATTATCACAAACAATGTAACTAAAAAAACAAAACTCCTCCATTAAGTTTGAACAATAATGCTATAATGGTAATAATAACGTTCGGTGTGTGCGTGTGTGCGTGGGGTTGATTTGTAGAGAGTAACAACGTGGAAGAAAGTGCACGTGATATACAGTTTCTTCTTTGTGAGAAAAGTGGTAGCCCATATAAACACCTTCATATTCTACTGTCTTGTATTACCGGCCACAGTGGTAGTACAAGATGTTGAAGTTCCTAAATGGGGATATGTTTACATTCCTGCTATCATTACTCTTCTCAATTCTGTTGGCACCCCAAGGTTCATAGATTTAGTTTCATTCATTTTGATTTTAGTTTTAAATTCTTGA ATGGTTGTGGAAATTATCACAAACAATAGAGTAACAACGTGGAAGAAAGTGCACGTGATATACAGTTTCTTCTTTGTGAGAAAAGTGGTAGCCCATATAAACACCTTCATATTCTACTGTCTTGTATTACCGGCCACAGTGGTAGTACAAGATGTTGAAGTTCCTAAATGGGGATATGTTTACATTCCTGCTATCATTACTCTTCTCAATTCTGTTGGCACCCCAAGGTTCATAGATTTAGTTTCATTCATTTTGATTTTAGTTTTAAATTCTTGA ATGGTTGTGGAAATTATCACAAACAATAGAGTAACAACGTGGAAGAAAGTGCACGTGATATACAGTTTCTTCTTTGTGAGAAAAGTGGTAGCCCATATAAACACCTTCATATTCTACTGTCTTGTATTACCGGCCACAGTGGTAGTACAAGATGTTGAAGTTCCTAAATGGGGATATGTTTACATTCCTGCTATCATTACTCTTCTCAATTCTGTTGGCACCCCAAGGTTCATAGATTTAGTTTCATTCATTTTGATTTTAGTTTTAAATTCTTGA MVVEIITNNRVTTWKKVHVIYSFFFVRKVVAHINTFIFYCLVLPATVVVQDVEVPKWGYVYIPAIITLLNSVGTPRFIDLVSFILILVLNS*
BLAST of MELO3C019311 vs. Swiss-Prot
Match: CSLA9_ORYSJ (Probable mannan synthase 9 OS=Oryza sativa subsp. japonica GN=CSLA9 PE=2 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 5.8e-29 Identity = 52/83 (62.65%), Postives = 71/83 (85.54%), Query Frame = 1
BLAST of MELO3C019311 vs. Swiss-Prot
Match: CSLA9_ARATH (Glucomannan 4-beta-mannosyltransferase 9 OS=Arabidopsis thaliana GN=CSLA9 PE=2 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 7.6e-29 Identity = 59/86 (68.60%), Postives = 70/86 (81.40%), Query Frame = 1
BLAST of MELO3C019311 vs. Swiss-Prot
Match: CSLA1_ORYSJ (Glucomannan 4-beta-mannosyltransferase 1 OS=Oryza sativa subsp. japonica GN=CSLA1 PE=2 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 6.4e-28 Identity = 53/86 (61.63%), Postives = 69/86 (80.23%), Query Frame = 1
BLAST of MELO3C019311 vs. Swiss-Prot
Match: CSLA2_ARATH (Glucomannan 4-beta-mannosyltransferase 2 OS=Arabidopsis thaliana GN=CSLA2 PE=2 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 3.5e-26 Identity = 54/86 (62.79%), Postives = 69/86 (80.23%), Query Frame = 1
BLAST of MELO3C019311 vs. Swiss-Prot
Match: CSLAE_ARATH (Probable mannan synthase 14 OS=Arabidopsis thaliana GN=CSLA14 PE=2 SV=2) HSP 1 Score: 110.5 bits (275), Expect = 9.6e-24 Identity = 49/87 (56.32%), Postives = 66/87 (75.86%), Query Frame = 1
BLAST of MELO3C019311 vs. TrEMBL
Match: A0A0A0KEU4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G450350 PE=4 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 5.8e-36 Identity = 76/86 (88.37%), Postives = 81/86 (94.19%), Query Frame = 1
BLAST of MELO3C019311 vs. TrEMBL
Match: A0A0A0KKD8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G450360 PE=4 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 7.4e-31 Identity = 64/86 (74.42%), Postives = 78/86 (90.70%), Query Frame = 1
BLAST of MELO3C019311 vs. TrEMBL
Match: A0A0L9TF33_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan641s001100 PE=4 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 4.1e-29 Identity = 60/86 (69.77%), Postives = 77/86 (89.53%), Query Frame = 1
BLAST of MELO3C019311 vs. TrEMBL
Match: A0A0S3RZ22_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.04G339700 PE=4 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 4.1e-29 Identity = 60/86 (69.77%), Postives = 77/86 (89.53%), Query Frame = 1
BLAST of MELO3C019311 vs. TrEMBL
Match: A0A0B2NZ07_GLYSO (Glucomannan 4-beta-mannosyltransferase 9 OS=Glycine soja GN=glysoja_002289 PE=4 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 5.3e-29 Identity = 61/86 (70.93%), Postives = 76/86 (88.37%), Query Frame = 1
BLAST of MELO3C019311 vs. TAIR10
Match: AT5G03760.1 (AT5G03760.1 Nucleotide-diphospho-sugar transferases superfamily protein) HSP 1 Score: 127.5 bits (319), Expect = 4.3e-30 Identity = 59/86 (68.60%), Postives = 70/86 (81.40%), Query Frame = 1
BLAST of MELO3C019311 vs. TAIR10
Match: AT5G22740.1 (AT5G22740.1 cellulose synthase-like A02) HSP 1 Score: 118.6 bits (296), Expect = 2.0e-27 Identity = 54/86 (62.79%), Postives = 69/86 (80.23%), Query Frame = 1
BLAST of MELO3C019311 vs. TAIR10
Match: AT3G56000.1 (AT3G56000.1 cellulose synthase like A14) HSP 1 Score: 110.5 bits (275), Expect = 5.4e-25 Identity = 49/87 (56.32%), Postives = 66/87 (75.86%), Query Frame = 1
BLAST of MELO3C019311 vs. TAIR10
Match: AT1G23480.1 (AT1G23480.1 cellulose synthase-like A3) HSP 1 Score: 109.8 bits (273), Expect = 9.2e-25 Identity = 44/86 (51.16%), Postives = 66/86 (76.74%), Query Frame = 1
BLAST of MELO3C019311 vs. TAIR10
Match: AT5G16190.1 (AT5G16190.1 cellulose synthase like A11) HSP 1 Score: 104.8 bits (260), Expect = 3.0e-23 Identity = 46/83 (55.42%), Postives = 56/83 (67.47%), Query Frame = 1
BLAST of MELO3C019311 vs. NCBI nr
Match: gi|449451098|ref|XP_004143299.1| (PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis sativus]) HSP 1 Score: 157.9 bits (398), Expect = 8.4e-36 Identity = 76/86 (88.37%), Postives = 81/86 (94.19%), Query Frame = 1
BLAST of MELO3C019311 vs. NCBI nr
Match: gi|449451100|ref|XP_004143300.1| (PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Cucumis sativus]) HSP 1 Score: 141.0 bits (354), Expect = 1.1e-30 Identity = 64/86 (74.42%), Postives = 78/86 (90.70%), Query Frame = 1
BLAST of MELO3C019311 vs. NCBI nr
Match: gi|659125140|ref|XP_008462529.1| (PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis melo]) HSP 1 Score: 140.2 bits (352), Expect = 1.8e-30 Identity = 64/86 (74.42%), Postives = 78/86 (90.70%), Query Frame = 1
BLAST of MELO3C019311 vs. NCBI nr
Match: gi|1021529432|ref|XP_016208106.1| (PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Arachis ipaensis]) HSP 1 Score: 138.3 bits (347), Expect = 6.9e-30 Identity = 63/86 (73.26%), Postives = 77/86 (89.53%), Query Frame = 1
BLAST of MELO3C019311 vs. NCBI nr
Match: gi|1012189990|ref|XP_015970387.1| (PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Arachis duranensis]) HSP 1 Score: 138.3 bits (347), Expect = 6.9e-30 Identity = 63/86 (73.26%), Postives = 77/86 (89.53%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |