MELO3C019242 (gene) Melon (DHL92) v3.5.1

NameMELO3C019242
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
DescriptionP-loop containing nucleoside triphosphate hydrolases superfamily protein
Locationchr11 : 9653241 .. 9653498 (+)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGATCGGCGTCGGCGGCAGGAGGCGAAACCCGGCGGCTGGCGGTGCTCGACGACGGGGAGGAGCGGTGGACAAAGCGTGGTTGAGGCGGCAGCGTCGGACCGACTTGCGAAAGGACAACCGACATGTAAAACCAGTTCGGGCGGCACGGAGACTCAGTGACGGTGTGCGGCTCGGTTGGGAGTCAGCTGAGGGAGGTTGTCCACGGCGAGGGAACGGCGGCGCGAACAAAAACCAGCGGGTCGACCGGTTTGTGTGA

mRNA sequence

ATGATCGGCGTCGGCGGCAGGAGGCGAAACCCGGCGGCTGGCGGTGCTCGACGACGGGGAGGAGCGGTGGACAAAGCGTGGTTGAGGCGGCAGCGTCGGACCGACTTGCGAAAGGACAACCGACATGTAAAACCAGTTCGGGCGGCACGGAGACTCAGTGACGGTGTGCGGCTCGGTTGGGAGTCAGCTGAGGGAGGTTGTCCACGGCGAGGGAACGGCGGCGCGAACAAAAACCAGCGGGTCGACCGGTTTGTGTGA

Coding sequence (CDS)

ATGATCGGCGTCGGCGGCAGGAGGCGAAACCCGGCGGCTGGCGGTGCTCGACGACGGGGAGGAGCGGTGGACAAAGCGTGGTTGAGGCGGCAGCGTCGGACCGACTTGCGAAAGGACAACCGACATGTAAAACCAGTTCGGGCGGCACGGAGACTCAGTGACGGTGTGCGGCTCGGTTGGGAGTCAGCTGAGGGAGGTTGTCCACGGCGAGGGAACGGCGGCGCGAACAAAAACCAGCGGGTCGACCGGTTTGTGTGA

Protein sequence

MIGVGGRRRNPAAGGARRRGGAVDKAWLRRQRRTDLRKDNRHVKPVRAARRLSDGVRLGWESAEGGCPRRGNGGANKNQRVDRFV*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function
molecular_function GO:0003723 RNA binding
This gene is associated with the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
MU67237melon EST collection version 4.0transcribed_cluster

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C019242T1MELO3C019242T1mRNA


The following transcribed_cluster feature(s) are associated with this gene:

Feature NameUnique NameType
MU67237MU67237transcribed_cluster


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C019242Watermelon (97103) v2mewmbB092
MELO3C019242Watermelon (97103) v2mewmbB106
MELO3C019242Wax gourdmewgoB107
MELO3C019242Wax gourdmewgoB126
MELO3C019242Melon (DHL92) v3.5.1memeB039
MELO3C019242Cucumber (Gy14) v1cgymeB014
MELO3C019242Cucumber (Gy14) v1cgymeB072
MELO3C019242Cucumber (Gy14) v1cgymeB246
MELO3C019242Cucurbita maxima (Rimu)cmameB087
MELO3C019242Cucurbita maxima (Rimu)cmameB451
MELO3C019242Cucurbita maxima (Rimu)cmameB502
MELO3C019242Cucurbita maxima (Rimu)cmameB533
MELO3C019242Cucurbita moschata (Rifu)cmomeB080
MELO3C019242Cucurbita moschata (Rifu)cmomeB443
MELO3C019242Cucurbita moschata (Rifu)cmomeB482
MELO3C019242Cucurbita moschata (Rifu)cmomeB523
MELO3C019242Cucurbita moschata (Rifu)cmomeB768
MELO3C019242Wild cucumber (PI 183967)cpimeB096
MELO3C019242Wild cucumber (PI 183967)cpimeB445
MELO3C019242Wild cucumber (PI 183967)cpimeB520
MELO3C019242Cucumber (Chinese Long) v2cumeB097
MELO3C019242Cucumber (Chinese Long) v2cumeB516
MELO3C019242Watermelon (Charleston Gray)mewcgB086
MELO3C019242Watermelon (Charleston Gray)mewcgB090
MELO3C019242Watermelon (Charleston Gray)mewcgB092
MELO3C019242Watermelon (97103) v1mewmB103
MELO3C019242Watermelon (97103) v1mewmB124
MELO3C019242Watermelon (97103) v1mewmB130
MELO3C019242Cucurbita pepo (Zucchini)cpemeB257
MELO3C019242Cucurbita pepo (Zucchini)cpemeB599
MELO3C019242Cucurbita pepo (Zucchini)cpemeB667
MELO3C019242Bottle gourd (USVL1VR-Ls)lsimeB053
MELO3C019242Bottle gourd (USVL1VR-Ls)lsimeB088
MELO3C019242Cucumber (Gy14) v2cgybmeB083
MELO3C019242Cucumber (Gy14) v2cgybmeB452
MELO3C019242Silver-seed gourdcarmeB0030
MELO3C019242Silver-seed gourdcarmeB0341
MELO3C019242Silver-seed gourdcarmeB0863
MELO3C019242Cucumber (Chinese Long) v3cucmeB103
MELO3C019242Cucumber (Chinese Long) v3cucmeB457
MELO3C019242Cucumber (Chinese Long) v3cucmeB532