MELO3C019218 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGCGATGGTGAGGGCGAGCTCCGGCTTGCAATATCCCGATCGGTTCTACGCCGCGGCTTCTTATGCCGGTTTTGATGGATCACCGAAATTGTCTTCAAAGGCCCTCAGGTCTAAGTTCTCTGATGAGGCCGCTTTGTTACTCTATGGCTTGTATCAGCAGGTACTACCACATGTTCTTACACCTGTGACTTACCGGTGCTGTTTCAGTTTGGTTAAGGTTTGA ATGGCTGCGATGGTGAGGGCGAGCTCCGGCTTGCAATATCCCGATCGGTTCTACGCCGCGGCTTCTTATGCCGGTTTTGATGGATCACCGAAATTGTCTTCAAAGGCCCTCAGGTCTAAGTTCTCTGATGAGGCCGCTTTGTTACTCTATGGCTTGTATCAGCAGGTACTACCACATGTTCTTACACCTGTGACTTACCGGTGCTGTTTCAGTTTGGTTAAGGTTTGA ATGGCTGCGATGGTGAGGGCGAGCTCCGGCTTGCAATATCCCGATCGGTTCTACGCCGCGGCTTCTTATGCCGGTTTTGATGGATCACCGAAATTGTCTTCAAAGGCCCTCAGGTCTAAGTTCTCTGATGAGGCCGCTTTGTTACTCTATGGCTTGTATCAGCAGGTACTACCACATGTTCTTACACCTGTGACTTACCGGTGCTGTTTCAGTTTGGTTAAGGTTTGA MAAMVRASSGLQYPDRFYAAASYAGFDGSPKLSSKALRSKFSDEAALLLYGLYQQVLPHVLTPVTYRCCFSLVKV*
BLAST of MELO3C019218 vs. Swiss-Prot
Match: ACBP5_ARATH (Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 4.1e-12 Identity = 38/55 (69.09%), Postives = 42/55 (76.36%), Query Frame = 1
BLAST of MELO3C019218 vs. Swiss-Prot
Match: ACBP4_ARATH (Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.3e-10 Identity = 35/53 (66.04%), Postives = 38/53 (71.70%), Query Frame = 1
BLAST of MELO3C019218 vs. TrEMBL
Match: A0A0A0LFW3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G030060 PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.2e-20 Identity = 53/55 (96.36%), Postives = 53/55 (96.36%), Query Frame = 1
BLAST of MELO3C019218 vs. TrEMBL
Match: M5WQY4_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa002406mg PE=4 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 7.3e-16 Identity = 43/53 (81.13%), Postives = 49/53 (92.45%), Query Frame = 1
BLAST of MELO3C019218 vs. TrEMBL
Match: D7U9T2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_14s0060g02410 PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.8e-14 Identity = 42/53 (79.25%), Postives = 45/53 (84.91%), Query Frame = 1
BLAST of MELO3C019218 vs. TrEMBL
Match: V4T0M2_9ROSI (Uncharacterized protein (Fragment) OS=Citrus clementina GN=CICLE_v100005042mg PE=4 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 5.2e-14 Identity = 41/53 (77.36%), Postives = 46/53 (86.79%), Query Frame = 1
BLAST of MELO3C019218 vs. TrEMBL
Match: A0A067EMH1_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0066451mg PE=4 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 5.2e-14 Identity = 41/53 (77.36%), Postives = 46/53 (86.79%), Query Frame = 1
BLAST of MELO3C019218 vs. TAIR10
Match: AT5G27630.1 (AT5G27630.1 acyl-CoA binding protein 5) HSP 1 Score: 71.6 bits (174), Expect = 2.3e-13 Identity = 38/55 (69.09%), Postives = 42/55 (76.36%), Query Frame = 1
BLAST of MELO3C019218 vs. TAIR10
Match: AT3G05420.2 (AT3G05420.2 acyl-CoA binding protein 4) HSP 1 Score: 66.6 bits (161), Expect = 7.4e-12 Identity = 35/53 (66.04%), Postives = 38/53 (71.70%), Query Frame = 1
BLAST of MELO3C019218 vs. NCBI nr
Match: gi|659125410|ref|XP_008462673.1| (PREDICTED: acyl-CoA-binding domain-containing protein 5-like [Cucumis melo]) HSP 1 Score: 108.2 bits (269), Expect = 6.3e-21 Identity = 54/55 (98.18%), Postives = 54/55 (98.18%), Query Frame = 1
BLAST of MELO3C019218 vs. NCBI nr
Match: gi|449454077|ref|XP_004144782.1| (PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform X1 [Cucumis sativus]) HSP 1 Score: 105.9 bits (263), Expect = 3.1e-20 Identity = 53/55 (96.36%), Postives = 53/55 (96.36%), Query Frame = 1
BLAST of MELO3C019218 vs. NCBI nr
Match: gi|778666903|ref|XP_011648837.1| (PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis sativus]) HSP 1 Score: 105.9 bits (263), Expect = 3.1e-20 Identity = 53/55 (96.36%), Postives = 53/55 (96.36%), Query Frame = 1
BLAST of MELO3C019218 vs. NCBI nr
Match: gi|659070284|ref|XP_008454338.1| (PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform X1 [Cucumis melo]) HSP 1 Score: 105.9 bits (263), Expect = 3.1e-20 Identity = 53/55 (96.36%), Postives = 53/55 (96.36%), Query Frame = 1
BLAST of MELO3C019218 vs. NCBI nr
Match: gi|659070286|ref|XP_008454347.1| (PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform X2 [Cucumis melo]) HSP 1 Score: 105.9 bits (263), Expect = 3.1e-20 Identity = 53/55 (96.36%), Postives = 53/55 (96.36%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|