MELO3C019212.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCAGAGGAATGGAAGCACACAAGAACAGATACATCGAGGATCGGAGTACTGCTAGAGAGAATCTTGAGCATAACTTCCGCTGGATTCGATGGAATTTCGCTGTTGTGGGTTTCTTCAGCATCGCCGTTCCCCTTCTTGTTTACAAGGGGTTAAGAGAATTTGTAATATAA ATGGGCAGAGGAATGGAAGCACACAAGAACAGATACATCGAGGATCGGAGTACTGCTAGAGAGAATCTTGAGCATAACTTCCGCTGGATTCGATGGAATTTCGCTGTTGTGGGTTTCTTCAGCATCGCCGTTCCCCTTCTTGTTTACAAGGGGTTAAGAGAATTTGTAATATAA ATGGGCAGAGGAATGGAAGCACACAAGAACAGATACATCGAGGATCGGAGTACTGCTAGAGAGAATCTTGAGCATAACTTCCGCTGGATTCGATGGAATTTCGCTGTTGTGGGTTTCTTCAGCATCGCCGTTCCCCTTCTTGTTTACAAGGGGTTAAGAGAATTTGTAATATAA MGRGMEAHKNRYIEDRSTARENLEHNFRWIRWNFAVVGFFSIAVPLLVYKGLREFVI
BLAST of MELO3C019212.2 vs. NCBI nr
Match: XP_022988537.1 (uncharacterized protein LOC111485748 [Cucurbita maxima] >XP_023516450.1 uncharacterized protein LOC111780310 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 91.7 bits (226), Expect = 8.9e-16 Identity = 45/56 (80.36%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of MELO3C019212.2 vs. NCBI nr
Match: KZV34329.1 (Pre T-cell antigen receptor alpha [Dorcoceras hygrometricum]) HSP 1 Score: 90.5 bits (223), Expect = 2.0e-15 Identity = 44/56 (78.57%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of MELO3C019212.2 vs. NCBI nr
Match: XP_022921830.1 (uncharacterized protein LOC111429971 [Cucurbita moschata]) HSP 1 Score: 90.5 bits (223), Expect = 2.0e-15 Identity = 44/56 (78.57%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of MELO3C019212.2 vs. NCBI nr
Match: OWM89248.1 (hypothetical protein CDL15_Pgr010535 [Punica granatum] >PKI59873.1 hypothetical protein CRG98_019755 [Punica granatum]) HSP 1 Score: 89.4 bits (220), Expect = 4.4e-15 Identity = 43/56 (76.79%), Postives = 48/56 (85.71%), Query Frame = 0
BLAST of MELO3C019212.2 vs. NCBI nr
Match: XP_007025728.1 (PREDICTED: uncharacterized protein LOC18596917 [Theobroma cacao] >EOY28350.1 Pre T-cell antigen receptor alpha [Theobroma cacao]) HSP 1 Score: 87.4 bits (215), Expect = 1.7e-14 Identity = 42/56 (75.00%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of MELO3C019212.2 vs. TAIR10
Match: AT2G31490.1 (unknown protein) HSP 1 Score: 79.3 bits (194), Expect = 8.3e-16 Identity = 34/52 (65.38%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of MELO3C019212.2 vs. TrEMBL
Match: tr|A0A218XWT9|A0A218XWT9_PUNGR (Uncharacterized protein OS=Punica granatum OX=22663 GN=CDL15_Pgr010535 PE=4 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.9e-15 Identity = 43/56 (76.79%), Postives = 48/56 (85.71%), Query Frame = 0
BLAST of MELO3C019212.2 vs. TrEMBL
Match: tr|A0A061GEQ2|A0A061GEQ2_THECC (Pre T-cell antigen receptor alpha OS=Theobroma cacao OX=3641 GN=TCM_029947 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.1e-14 Identity = 42/56 (75.00%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of MELO3C019212.2 vs. TrEMBL
Match: tr|A0A2G9GC84|A0A2G9GC84_9LAMI (NADH:ubiquinone reductase (H(+)-translocating) OS=Handroanthus impetiginosus OX=429701 GN=CDL12_24572 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.1e-14 Identity = 41/56 (73.21%), Postives = 48/56 (85.71%), Query Frame = 0
BLAST of MELO3C019212.2 vs. TrEMBL
Match: tr|A0A2I4HAE4|A0A2I4HAE4_9ROSI (uncharacterized protein LOC108981675 OS=Juglans regia OX=51240 GN=LOC109015106 PE=4 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 3.2e-14 Identity = 41/56 (73.21%), Postives = 48/56 (85.71%), Query Frame = 0
BLAST of MELO3C019212.2 vs. TrEMBL
Match: tr|A0A059CK03|A0A059CK03_EUCGR (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_D02622 PE=4 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 3.2e-14 Identity = 40/56 (71.43%), Postives = 47/56 (83.93%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|