MELO3C019176.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGAGTGTAAAGTGGCAAAAAGAGTTGTTTCGTGATGTTGAAATTGATACCAGTCTGCCCCCATATTATTTGAAAGGCCAGTTGTTTAAACTCACCGGTGTGCCTCCTGAACGGCAGAAGATTATGATTAAGGGTTGTATACTAAAGGTTACTTGA ATGGTGAGTGTAAAGTGGCAAAAAGAGTTGTTTCGTGATGTTGAAATTGATACCAGTCTGCCCCCATATTATTTGAAAGGCCAGTTGTTTAAACTCACCGGTGTGCCTCCTGAACGGCAGAAGATTATGATTAAGGGTTGTATACTAAAGGTTACTTGA ATGGTGAGTGTAAAGTGGCAAAAAGAGTTGTTTCGTGATGTTGAAATTGATACCAGTCTGCCCCCATATTATTTGAAAGGCCAGTTGTTTAAACTCACCGGTGTGCCTCCTGAACGGCAGAAGATTATGATTAAGGGTTGTATACTAAAGGTTACTTGA MVSVKWQKELFRDVEIDTSLPPYYLKGQLFKLTGVPPERQKIMIKGCILKVT
BLAST of MELO3C019176.2 vs. NCBI nr
Match: XP_004141674.1 (PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 [Cucumis sativus] >KGN45539.1 hypothetical protein Csa_7G451940 [Cucumis sativus]) HSP 1 Score: 94.0 bits (232), Expect = 1.6e-16 Identity = 44/49 (89.80%), Postives = 46/49 (93.88%), Query Frame = 0
BLAST of MELO3C019176.2 vs. NCBI nr
Match: XP_008462369.1 (PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 [Cucumis melo]) HSP 1 Score: 94.0 bits (232), Expect = 1.6e-16 Identity = 44/49 (89.80%), Postives = 46/49 (93.88%), Query Frame = 0
BLAST of MELO3C019176.2 vs. NCBI nr
Match: XP_022953492.1 (ubiquitin carboxyl-terminal hydrolase 6-like isoform X1 [Cucurbita moschata] >XP_022953493.1 ubiquitin carboxyl-terminal hydrolase 6-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 92.4 bits (228), Expect = 4.8e-16 Identity = 43/49 (87.76%), Postives = 46/49 (93.88%), Query Frame = 0
BLAST of MELO3C019176.2 vs. NCBI nr
Match: XP_023547864.1 (ubiquitin carboxyl-terminal hydrolase 6-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 92.4 bits (228), Expect = 4.8e-16 Identity = 43/49 (87.76%), Postives = 46/49 (93.88%), Query Frame = 0
BLAST of MELO3C019176.2 vs. NCBI nr
Match: XP_022964137.1 (ubiquitin carboxyl-terminal hydrolase 6-like [Cucurbita moschata]) HSP 1 Score: 91.7 bits (226), Expect = 8.1e-16 Identity = 43/49 (87.76%), Postives = 45/49 (91.84%), Query Frame = 0
BLAST of MELO3C019176.2 vs. TAIR10
Match: AT1G51710.1 (ubiquitin-specific protease 6) HSP 1 Score: 76.3 bits (186), Expect = 6.4e-15 Identity = 34/49 (69.39%), Postives = 40/49 (81.63%), Query Frame = 0
BLAST of MELO3C019176.2 vs. TAIR10
Match: AT3G21280.1 (ubiquitin-specific protease 7) HSP 1 Score: 76.3 bits (186), Expect = 6.4e-15 Identity = 33/49 (67.35%), Postives = 41/49 (83.67%), Query Frame = 0
BLAST of MELO3C019176.2 vs. Swiss-Prot
Match: sp|Q949Y0|UBP6_ARATH (Ubiquitin carboxyl-terminal hydrolase 6 OS=Arabidopsis thaliana OX=3702 GN=UBP6 PE=1 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.2e-13 Identity = 34/49 (69.39%), Postives = 40/49 (81.63%), Query Frame = 0
BLAST of MELO3C019176.2 vs. Swiss-Prot
Match: sp|Q84WC6|UBP7_ARATH (Ubiquitin carboxyl-terminal hydrolase 7 OS=Arabidopsis thaliana OX=3702 GN=UBP7 PE=1 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.2e-13 Identity = 33/49 (67.35%), Postives = 41/49 (83.67%), Query Frame = 0
BLAST of MELO3C019176.2 vs. Swiss-Prot
Match: sp|Q0IIF7|UBP14_BOVIN (Ubiquitin carboxyl-terminal hydrolase 14 OS=Bos taurus OX=9913 GN=USP14 PE=2 SV=3) HSP 1 Score: 62.4 bits (150), Expect = 1.7e-09 Identity = 29/49 (59.18%), Postives = 34/49 (69.39%), Query Frame = 0
BLAST of MELO3C019176.2 vs. Swiss-Prot
Match: sp|P54578|UBP14_HUMAN (Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3) HSP 1 Score: 62.4 bits (150), Expect = 1.7e-09 Identity = 29/49 (59.18%), Postives = 34/49 (69.39%), Query Frame = 0
BLAST of MELO3C019176.2 vs. Swiss-Prot
Match: sp|Q9JMA1|UBP14_MOUSE (Ubiquitin carboxyl-terminal hydrolase 14 OS=Mus musculus OX=10090 GN=Usp14 PE=1 SV=3) HSP 1 Score: 62.4 bits (150), Expect = 1.7e-09 Identity = 29/49 (59.18%), Postives = 34/49 (69.39%), Query Frame = 0
BLAST of MELO3C019176.2 vs. TrEMBL
Match: tr|A0A1S3CIC3|A0A1S3CIC3_CUCME (ubiquitin carboxyl-terminal hydrolase 6 OS=Cucumis melo OX=3656 GN=LOC103500742 PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 1.1e-16 Identity = 44/49 (89.80%), Postives = 46/49 (93.88%), Query Frame = 0
BLAST of MELO3C019176.2 vs. TrEMBL
Match: tr|A0A0A0K9N4|A0A0A0K9N4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G451940 PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 1.1e-16 Identity = 44/49 (89.80%), Postives = 46/49 (93.88%), Query Frame = 0
BLAST of MELO3C019176.2 vs. TrEMBL
Match: tr|A0A072TN68|A0A072TN68_MEDTR (Ubiquitin carboxyl-terminal hydrolase OS=Medicago truncatula OX=3880 GN=25500399 PE=3 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.9e-14 Identity = 40/50 (80.00%), Postives = 44/50 (88.00%), Query Frame = 0
BLAST of MELO3C019176.2 vs. TrEMBL
Match: tr|A0A1S2YUY9|A0A1S2YUY9_CICAR (ubiquitin carboxyl-terminal hydrolase 6-like OS=Cicer arietinum OX=3827 GN=LOC101499834 PE=3 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 3.8e-14 Identity = 40/49 (81.63%), Postives = 43/49 (87.76%), Query Frame = 0
BLAST of MELO3C019176.2 vs. TrEMBL
Match: tr|A0A2I0LFJ5|A0A2I0LFJ5_PUNGR (Uncharacterized protein OS=Punica granatum OX=22663 GN=CRG98_000149 PE=3 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 5.0e-14 Identity = 40/49 (81.63%), Postives = 43/49 (87.76%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|