MELO3C018993 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTTTGACTCTCTGTTTTGGAATATACTTCAGGTGTGCGAAGTTGGTGAGTTATCAGAGATATTCCAATGGAAAGGGGAGGTTCCAAGTGGCCTTCCTGACTGGAAAGAAGAAGAGAAGCAACATCTTGGTGAAGAACTATCAGATGTTTTGCTTTATCTTGTTAGACTTGCTGATATTTGTGGGATTGATCTTGATAAAGCAGTACTAAGGAAGCTGGAGCTGAATGGGAAGAAATATCCGGTCAAGCTTTGTAAAGGGTCATCAAGAAAACACAGAAATCTGCTGCAAAGAAGATTGCAATGA ATGGCTTTTGACTCTCTGTTTTGGAATATACTTCAGGTGTGCGAAGTTGGTGAGTTATCAGAGATATTCCAATGGAAAGGGGAGGTTCCAAGTGGCCTTCCTGACTGGAAAGAAGAAGAGAAGCAACATCTTGGTGAAGAACTATCAGATGTTTTGCTTTATCTTGTTAGACTTGCTGATATTTGTGGGATTGATCTTGATAAAGCAGTACTAAGGAAGCTGGAGCTGAATGGGAAGAAATATCCGGTCAAGCTTTGTAAAGGGTCATCAAGAAAACACAGAAATCTGCTGCAAAGAAGATTGCAATGA ATGGCTTTTGACTCTCTGTTTTGGAATATACTTCAGGTGTGCGAAGTTGGTGAGTTATCAGAGATATTCCAATGGAAAGGGGAGGTTCCAAGTGGCCTTCCTGACTGGAAAGAAGAAGAGAAGCAACATCTTGGTGAAGAACTATCAGATGTTTTGCTTTATCTTGTTAGACTTGCTGATATTTGTGGGATTGATCTTGATAAAGCAGTACTAAGGAAGCTGGAGCTGAATGGGAAGAAATATCCGGTCAAGCTTTGTAAAGGGTCATCAAGAAAACACAGAAATCTGCTGCAAAGAAGATTGCAATGA MAFDSLFWNILQVCEVGELSEIFQWKGEVPSGLPDWKEEEKQHLGEELSDVLLYLVRLADICGIDLDKAVLRKLELNGKKYPVKLCKGSSRKHRNLLQRRLQ*
BLAST of MELO3C018993 vs. Swiss-Prot
Match: DCTP1_RAT (dCTP pyrophosphatase 1 OS=Rattus norvegicus GN=Dctpp1 PE=2 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 9.8e-17 Identity = 42/84 (50.00%), Postives = 58/84 (69.05%), Query Frame = 1
BLAST of MELO3C018993 vs. Swiss-Prot
Match: DCTP1_HUMAN (dCTP pyrophosphatase 1 OS=Homo sapiens GN=DCTPP1 PE=1 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.2e-16 Identity = 43/84 (51.19%), Postives = 54/84 (64.29%), Query Frame = 1
BLAST of MELO3C018993 vs. Swiss-Prot
Match: DCTP1_MOUSE (dCTP pyrophosphatase 1 OS=Mus musculus GN=Dctpp1 PE=1 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.2e-16 Identity = 42/84 (50.00%), Postives = 57/84 (67.86%), Query Frame = 1
BLAST of MELO3C018993 vs. Swiss-Prot
Match: DCTP1_BOVIN (dCTP pyrophosphatase 1 OS=Bos taurus GN=DCTPP1 PE=2 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 6.3e-16 Identity = 42/84 (50.00%), Postives = 56/84 (66.67%), Query Frame = 1
BLAST of MELO3C018993 vs. TrEMBL
Match: A0A0A0KW27_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G012500 PE=4 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 1.8e-38 Identity = 78/88 (88.64%), Postives = 82/88 (93.18%), Query Frame = 1
BLAST of MELO3C018993 vs. TrEMBL
Match: D7U9K5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_05s0062g00820 PE=4 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 3.6e-34 Identity = 72/84 (85.71%), Postives = 76/84 (90.48%), Query Frame = 1
BLAST of MELO3C018993 vs. TrEMBL
Match: M0T6A3_MUSAM (Uncharacterized protein OS=Musa acuminata subsp. malaccensis PE=4 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 1.8e-33 Identity = 71/81 (87.65%), Postives = 75/81 (92.59%), Query Frame = 1
BLAST of MELO3C018993 vs. TrEMBL
Match: A0A061ERV9_THECC (RS21-C6, EAR, NTP pyrophosphohydrolase MazG catalytic core, putative isoform 1 OS=Theobroma cacao GN=TCM_020157 PE=4 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 1.8e-33 Identity = 70/84 (83.33%), Postives = 77/84 (91.67%), Query Frame = 1
BLAST of MELO3C018993 vs. TrEMBL
Match: A0A118K4Y2_CYNCS (Uncharacterized protein OS=Cynara cardunculus var. scolymus GN=Ccrd_013396 PE=4 SV=1) HSP 1 Score: 145.2 bits (365), Expect = 4.4e-32 Identity = 67/85 (78.82%), Postives = 75/85 (88.24%), Query Frame = 1
BLAST of MELO3C018993 vs. TAIR10
Match: AT3G25400.1 (AT3G25400.1 NTP Pyrophosphohydrolase MazG-related, RS21-C6 (InterPro:IPR011394), EAR (InterPro:IPR009039), NTP pyrophosphohydrolase MazG, putative catalytic core (InterPro:IPR004518)) HSP 1 Score: 120.9 bits (302), Expect = 4.5e-28 Identity = 58/74 (78.38%), Postives = 60/74 (81.08%), Query Frame = 1
BLAST of MELO3C018993 vs. NCBI nr
Match: gi|449468802|ref|XP_004152110.1| (PREDICTED: dCTP pyrophosphatase 1-like [Cucumis sativus]) HSP 1 Score: 166.4 bits (420), Expect = 2.6e-38 Identity = 78/88 (88.64%), Postives = 82/88 (93.18%), Query Frame = 1
BLAST of MELO3C018993 vs. NCBI nr
Match: gi|659108073|ref|XP_008454003.1| (PREDICTED: dCTP pyrophosphatase 1-like [Cucumis melo]) HSP 1 Score: 159.8 bits (403), Expect = 2.5e-36 Identity = 76/87 (87.36%), Postives = 80/87 (91.95%), Query Frame = 1
BLAST of MELO3C018993 vs. NCBI nr
Match: gi|296089600|emb|CBI39419.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 152.1 bits (383), Expect = 5.2e-34 Identity = 72/84 (85.71%), Postives = 76/84 (90.48%), Query Frame = 1
BLAST of MELO3C018993 vs. NCBI nr
Match: gi|359477978|ref|XP_002264474.2| (PREDICTED: dCTP pyrophosphatase 1-like [Vitis vinifera]) HSP 1 Score: 152.1 bits (383), Expect = 5.2e-34 Identity = 72/84 (85.71%), Postives = 76/84 (90.48%), Query Frame = 1
BLAST of MELO3C018993 vs. NCBI nr
Match: gi|1021027316|gb|KZM85103.1| (hypothetical protein DCAR_027475 [Daucus carota subsp. sativus]) HSP 1 Score: 151.0 bits (380), Expect = 1.1e-33 Identity = 71/88 (80.68%), Postives = 78/88 (88.64%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |