MELO3C018901 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGAAATGTTGCACCATTGGAAACATTGGTGATGGATGAAGCTGTACAGTTGAAGGAGTGTGAGTCTGCAATTCCTTTGCAATTTCCTGCTATAAAGCATGCAATTCTTTTTGGTGATGAGTGCGAATTGCCTGCCATGGTTGAAAGCAAA ATGCGAAATGTTGCACCATTGGAAACATTGGTGATGGATGAAGCTGTACAGTTGAAGGAGTGTGAGTCTGCAATTCCTTTGCAATTTCCTGCTATAAAGCATGCAATTCTTTTTGGTGATGAGTGCGAATTGCCTGCCATGGTTGAAAGCAAA ATGCGAAATGTTGCACCATTGGAAACATTGGTGATGGATGAAGCTGTACAGTTGAAGGAGTGTGAGTCTGCAATTCCTTTGCAATTTCCTGCTATAAAGCATGCAATTCTTTTTGGTGATGAGTGCGAATTGCCTGCCATGGTTGAAAGCAAA MRNVAPLETLVMDEAVQLKECESAIPLQFPAIKHAILFGDECELPAMVESK
BLAST of MELO3C018901 vs. TrEMBL
Match: A0A0A0K415_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G291110 PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 1.4e-18 Identity = 48/51 (94.12%), Postives = 49/51 (96.08%), Query Frame = 1
BLAST of MELO3C018901 vs. TrEMBL
Match: F6HG18_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_01s0010g01850 PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 3.3e-12 Identity = 36/49 (73.47%), Postives = 41/49 (83.67%), Query Frame = 1
BLAST of MELO3C018901 vs. TrEMBL
Match: F6HG18_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_01s0010g01850 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 7.0e-07 Identity = 29/48 (60.42%), Postives = 36/48 (75.00%), Query Frame = 1
HSP 2 Score: 73.6 bits (179), Expect = 8.0e-11 Identity = 33/45 (73.33%), Postives = 39/45 (86.67%), Query Frame = 1
BLAST of MELO3C018901 vs. TrEMBL
Match: A0A0D9W8L0_9ORYZ (Uncharacterized protein OS=Leersia perrieri PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 8.9e-10 Identity = 32/45 (71.11%), Postives = 37/45 (82.22%), Query Frame = 1
HSP 2 Score: 63.5 bits (153), Expect = 8.3e-08 Identity = 28/45 (62.22%), Postives = 36/45 (80.00%), Query Frame = 1
HSP 3 Score: 62.8 bits (151), Expect = 1.4e-07 Identity = 30/45 (66.67%), Postives = 35/45 (77.78%), Query Frame = 1
HSP 4 Score: 73.6 bits (179), Expect = 8.0e-11 Identity = 33/45 (73.33%), Postives = 39/45 (86.67%), Query Frame = 1
BLAST of MELO3C018901 vs. TrEMBL
Match: A0A0D9W8L2_9ORYZ (Uncharacterized protein OS=Leersia perrieri PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 8.9e-10 Identity = 32/45 (71.11%), Postives = 37/45 (82.22%), Query Frame = 1
HSP 2 Score: 62.8 bits (151), Expect = 1.4e-07 Identity = 30/45 (66.67%), Postives = 35/45 (77.78%), Query Frame = 1
HSP 3 Score: 73.6 bits (179), Expect = 8.0e-11 Identity = 33/45 (73.33%), Postives = 39/45 (86.67%), Query Frame = 1
BLAST of MELO3C018901 vs. TAIR10
Match: AT1G65780.1 (AT1G65780.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 68.2 bits (165), Expect = 1.7e-12 Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 1
BLAST of MELO3C018901 vs. TAIR10
Match: AT1G65810.1 (AT1G65810.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 66.6 bits (161), Expect = 5.0e-12 Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 1
BLAST of MELO3C018901 vs. TAIR10
Match: AT5G37030.1 (AT5G37030.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 61.6 bits (148), Expect = 1.6e-10 Identity = 28/44 (63.64%), Postives = 32/44 (72.73%), Query Frame = 1
BLAST of MELO3C018901 vs. TAIR10
Match: AT5G52090.1 (AT5G52090.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 61.2 bits (147), Expect = 2.1e-10 Identity = 28/45 (62.22%), Postives = 33/45 (73.33%), Query Frame = 1
BLAST of MELO3C018901 vs. TAIR10
Match: AT5G37150.1 (AT5G37150.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 61.2 bits (147), Expect = 2.1e-10 Identity = 28/45 (62.22%), Postives = 33/45 (73.33%), Query Frame = 1
BLAST of MELO3C018901 vs. NCBI nr
Match: gi|449443986|ref|XP_004139756.1| (PREDICTED: uncharacterized protein LOC101214715 [Cucumis sativus]) HSP 1 Score: 99.4 bits (246), Expect = 2.0e-18 Identity = 48/51 (94.12%), Postives = 49/51 (96.08%), Query Frame = 1
BLAST of MELO3C018901 vs. NCBI nr
Match: gi|700189207|gb|KGN44440.1| (hypothetical protein Csa_7G291110 [Cucumis sativus]) HSP 1 Score: 99.4 bits (246), Expect = 2.0e-18 Identity = 48/51 (94.12%), Postives = 49/51 (96.08%), Query Frame = 1
BLAST of MELO3C018901 vs. NCBI nr
Match: gi|659123169|ref|XP_008461528.1| (PREDICTED: uncharacterized protein LOC103500100 [Cucumis melo]) HSP 1 Score: 99.4 bits (246), Expect = 2.0e-18 Identity = 48/51 (94.12%), Postives = 49/51 (96.08%), Query Frame = 1
BLAST of MELO3C018901 vs. NCBI nr
Match: gi|778730286|ref|XP_011659750.1| (PREDICTED: regulator of nonsense transcripts 1 homolog [Cucumis sativus]) HSP 1 Score: 90.1 bits (222), Expect = 1.2e-15 Identity = 42/50 (84.00%), Postives = 47/50 (94.00%), Query Frame = 1
BLAST of MELO3C018901 vs. NCBI nr
Match: gi|700189149|gb|KGN44382.1| (hypothetical protein Csa_7G276680 [Cucumis sativus]) HSP 1 Score: 90.1 bits (222), Expect = 1.2e-15 Identity = 42/50 (84.00%), Postives = 47/50 (94.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|