MELO3C018325 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGTCTCCTTAGGAAATTGGAGGCTGATGTAGAAATTGAGGCACCAGCTTCAAAATTTCATGAATTGCTACAAAAGAGATTACACCATGTGTCCAAAGCTTCTGGAGACAAAGTTCAAAGCTGTGAATTGCATGAGGGTGATTGGGGAAAAGTTGGTTCTATCATCTCTTGGAACTACTTTCATGGTTCGATATTTTAA ATGTGTCTCCTTAGGAAATTGGAGGCTGATGTAGAAATTGAGGCACCAGCTTCAAAATTTCATGAATTGCTACAAAAGAGATTACACCATGTGTCCAAAGCTTCTGGAGACAAAGTTCAAAGCTGTGAATTGCATGAGGGTGATTGGGGAAAAGTTGGTTCTATCATCTCTTGGAACTACTTTCATGGTTCGATATTTTAA ATGTGTCTCCTTAGGAAATTGGAGGCTGATGTAGAAATTGAGGCACCAGCTTCAAAATTTCATGAATTGCTACAAAAGAGATTACACCATGTGTCCAAAGCTTCTGGAGACAAAGTTCAAAGCTGTGAATTGCATGAGGGTGATTGGGGAAAAGTTGGTTCTATCATCTCTTGGAACTACTTTCATGGTTCGATATTTTAA MCLLRKLEADVEIEAPASKFHELLQKRLHHVSKASGDKVQSCELHEGDWGKVGSIISWNYFHGSIF*
BLAST of MELO3C018325 vs. Swiss-Prot
Match: MLP31_ARATH (MLP-like protein 31 OS=Arabidopsis thaliana GN=MLP31 PE=2 SV=2) HSP 1 Score: 89.4 bits (220), Expect = 1.7e-17 Identity = 39/60 (65.00%), Postives = 43/60 (71.67%), Query Frame = 1
BLAST of MELO3C018325 vs. Swiss-Prot
Match: MLP43_ARATH (MLP-like protein 43 OS=Arabidopsis thaliana GN=MLP43 PE=1 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 2.9e-17 Identity = 38/60 (63.33%), Postives = 44/60 (73.33%), Query Frame = 1
BLAST of MELO3C018325 vs. Swiss-Prot
Match: MLP28_ARATH (MLP-like protein 28 OS=Arabidopsis thaliana GN=MLP28 PE=1 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 1.8e-16 Identity = 37/60 (61.67%), Postives = 43/60 (71.67%), Query Frame = 1
HSP 2 Score: 85.1 bits (209), Expect = 3.2e-16 Identity = 37/60 (61.67%), Postives = 42/60 (70.00%), Query Frame = 1
BLAST of MELO3C018325 vs. Swiss-Prot
Match: MLP34_ARATH (MLP-like protein 34 OS=Arabidopsis thaliana GN=MLP34 PE=2 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 9.2e-16 Identity = 36/60 (60.00%), Postives = 44/60 (73.33%), Query Frame = 1
HSP 2 Score: 80.9 bits (198), Expect = 5.9e-15 Identity = 34/56 (60.71%), Postives = 41/56 (73.21%), Query Frame = 1
BLAST of MELO3C018325 vs. Swiss-Prot
Match: ML165_ARATH (MLP-like protein 165 OS=Arabidopsis thaliana GN=MLP165 PE=2 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 7.8e-07 Identity = 25/53 (47.17%), Postives = 36/53 (67.92%), Query Frame = 1
BLAST of MELO3C018325 vs. TrEMBL
Match: A0A0A0L885_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G171860 PE=4 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.0e-17 Identity = 43/60 (71.67%), Postives = 48/60 (80.00%), Query Frame = 1
BLAST of MELO3C018325 vs. TrEMBL
Match: A0A078BZK7_BRANA (BnaA07g23680D protein OS=Brassica napus GN=BnaA07g23680D PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.7e-16 Identity = 40/61 (65.57%), Postives = 48/61 (78.69%), Query Frame = 1
BLAST of MELO3C018325 vs. TrEMBL
Match: A0A078GDP2_BRANA (BnaC06g24430D protein OS=Brassica napus GN=BnaC06g24430D PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.7e-16 Identity = 40/61 (65.57%), Postives = 48/61 (78.69%), Query Frame = 1
BLAST of MELO3C018325 vs. TrEMBL
Match: M4CIA6_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.7e-16 Identity = 40/61 (65.57%), Postives = 48/61 (78.69%), Query Frame = 1
BLAST of MELO3C018325 vs. TrEMBL
Match: A0A0A0KMB4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G266880 PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.7e-16 Identity = 37/62 (59.68%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of MELO3C018325 vs. TAIR10
Match: AT1G70840.1 (AT1G70840.1 MLP-like protein 31) HSP 1 Score: 89.4 bits (220), Expect = 9.4e-19 Identity = 39/60 (65.00%), Postives = 43/60 (71.67%), Query Frame = 1
BLAST of MELO3C018325 vs. TAIR10
Match: AT1G70890.1 (AT1G70890.1 MLP-like protein 43) HSP 1 Score: 88.6 bits (218), Expect = 1.6e-18 Identity = 38/60 (63.33%), Postives = 44/60 (73.33%), Query Frame = 1
BLAST of MELO3C018325 vs. TAIR10
Match: AT1G70830.1 (AT1G70830.1 MLP-like protein 28) HSP 1 Score: 85.9 bits (211), Expect = 1.0e-17 Identity = 37/60 (61.67%), Postives = 43/60 (71.67%), Query Frame = 1
HSP 2 Score: 85.1 bits (209), Expect = 1.8e-17 Identity = 37/60 (61.67%), Postives = 42/60 (70.00%), Query Frame = 1
BLAST of MELO3C018325 vs. TAIR10
Match: AT1G70850.1 (AT1G70850.1 MLP-like protein 34) HSP 1 Score: 83.6 bits (205), Expect = 5.2e-17 Identity = 36/60 (60.00%), Postives = 44/60 (73.33%), Query Frame = 1
HSP 2 Score: 80.9 bits (198), Expect = 3.3e-16 Identity = 34/56 (60.71%), Postives = 41/56 (73.21%), Query Frame = 1
BLAST of MELO3C018325 vs. TAIR10
Match: AT5G28010.1 (AT5G28010.1 Polyketide cyclase/dehydrase and lipid transport superfamily protein) HSP 1 Score: 80.1 bits (196), Expect = 5.7e-16 Identity = 35/60 (58.33%), Postives = 44/60 (73.33%), Query Frame = 1
BLAST of MELO3C018325 vs. NCBI nr
Match: gi|659109761|ref|XP_008454863.1| (PREDICTED: MLP-like protein 43 [Cucumis melo]) HSP 1 Score: 141.4 bits (355), Expect = 5.9e-31 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 1
BLAST of MELO3C018325 vs. NCBI nr
Match: gi|449445429|ref|XP_004140475.1| (PREDICTED: MLP-like protein 31 [Cucumis sativus]) HSP 1 Score: 124.4 bits (311), Expect = 7.5e-26 Identity = 58/62 (93.55%), Postives = 59/62 (95.16%), Query Frame = 1
BLAST of MELO3C018325 vs. NCBI nr
Match: gi|659077112|ref|XP_008439039.1| (PREDICTED: MLP-like protein 43 [Cucumis melo]) HSP 1 Score: 97.8 bits (242), Expect = 7.5e-18 Identity = 45/62 (72.58%), Postives = 49/62 (79.03%), Query Frame = 1
BLAST of MELO3C018325 vs. NCBI nr
Match: gi|449459826|ref|XP_004147647.1| (PREDICTED: MLP-like protein 31 [Cucumis sativus]) HSP 1 Score: 95.9 bits (237), Expect = 2.9e-17 Identity = 43/60 (71.67%), Postives = 48/60 (80.00%), Query Frame = 1
BLAST of MELO3C018325 vs. NCBI nr
Match: gi|685273586|ref|XP_009127832.1| (PREDICTED: MLP-like protein 31 [Brassica rapa]) HSP 1 Score: 91.7 bits (226), Expect = 5.4e-16 Identity = 39/60 (65.00%), Postives = 47/60 (78.33%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|