MELO3C016702 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGAGCACAAATCTCCTCCAATTCCCTCTCCTTCAATCCCACTTCCGCCCACCGTCCACTCTTCTTTTTCCCCCCGTCAAATCCCATCTCTCCGTTGTCTCAATCTCTTTCCCCACCTCCCAATTCCTCCATACCCCTTCCCACGCTCCTCCAGGCTTCGCTCTCATGGCCAAGTCTCCAAAAAACGACACCTCCGAGCAGAAATTGAGCCATGAAGGATCCGTCGTCGAGTCTCTTCCCAATGGGATGTTCAGGGTTCGATTGGATAATGAAGACCTCATTTTAGGCTACATATCCGGTAAGATTCGGAAGAATTTTGTTCGTATTTTACCTGGTGATAGGGTTAGGGTTGAAGTTAGTCGTTATGATTCTACCAAAGGTCGAATTGTTTATAGACTTCGAAGTAGTGGTAAAGACTCATCTTCATGA ATGTCGAGCACAAATCTCCTCCAATTCCCTCTCCTTCAATCCCACTTCCGCCCACCGTCCACTCTTCTTTTTCCCCCCGTCAAATCCCATCTCTCCGTTGTCTCAATCTCTTTCCCCACCTCCCAATTCCTCCATACCCCTTCCCACGCTCCTCCAGGCTTCGCTCTCATGGCCAAGTCTCCAAAAAACGACACCTCCGAGCAGAAATTGAGCCATGAAGGATCCGTCGTCGAGTCTCTTCCCAATGGGATGTTCAGGGTTCGATTGGATAATGAAGACCTCATTTTAGGCTACATATCCGGTAAGATTCGGAAGAATTTTGTTCGTATTTTACCTGGTGATAGGGTTAGGGTTGAAGTTAGTCGTTATGATTCTACCAAAGGTCGAATTGTTTATAGACTTCGAAGTAGTGGTAAAGACTCATCTTCATGA ATGTCGAGCACAAATCTCCTCCAATTCCCTCTCCTTCAATCCCACTTCCGCCCACCGTCCACTCTTCTTTTTCCCCCCGTCAAATCCCATCTCTCCGTTGTCTCAATCTCTTTCCCCACCTCCCAATTCCTCCATACCCCTTCCCACGCTCCTCCAGGCTTCGCTCTCATGGCCAAGTCTCCAAAAAACGACACCTCCGAGCAGAAATTGAGCCATGAAGGATCCGTCGTCGAGTCTCTTCCCAATGGGATGTTCAGGGTTCGATTGGATAATGAAGACCTCATTTTAGGCTACATATCCGGTAAGATTCGGAAGAATTTTGTTCGTATTTTACCTGGTGATAGGGTTAGGGTTGAAGTTAGTCGTTATGATTCTACCAAAGGTCGAATTGTTTATAGACTTCGAAGTAGTGGTAAAGACTCATCTTCATGA MSSTNLLQFPLLQSHFRPPSTLLFPPVKSHLSVVSISFPTSQFLHTPSHAPPGFALMAKSPKNDTSEQKLSHEGSVVESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVRVEVSRYDSTKGRIVYRLRSSGKDSSS*
BLAST of MELO3C016702 vs. Swiss-Prot
Match: IF1C_SOYBN (Translation initiation factor IF-1, chloroplastic OS=Glycine max GN=infA PE=2 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 2.7e-11 Identity = 42/64 (65.62%), Postives = 42/64 (65.62%), Query Frame = 1
BLAST of MELO3C016702 vs. Swiss-Prot
Match: IF1C_ASACA (Translation initiation factor IF-1, chloroplastic OS=Asarum canadense GN=infA PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 2.3e-10 Identity = 30/35 (85.71%), Postives = 31/35 (88.57%), Query Frame = 1
BLAST of MELO3C016702 vs. Swiss-Prot
Match: IF1C_DIOEL (Translation initiation factor IF-1, chloroplastic OS=Dioscorea elephantipes GN=infA PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 2.3e-10 Identity = 30/35 (85.71%), Postives = 31/35 (88.57%), Query Frame = 1
BLAST of MELO3C016702 vs. Swiss-Prot
Match: IF1C_PHAAO (Translation initiation factor IF-1, chloroplastic OS=Phalaenopsis aphrodite subsp. formosana GN=infA PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 3.8e-10 Identity = 31/35 (88.57%), Postives = 30/35 (85.71%), Query Frame = 1
BLAST of MELO3C016702 vs. Swiss-Prot
Match: IF1C_LIRTU (Translation initiation factor IF-1, chloroplastic OS=Liriodendron tulipifera GN=infA PE=3 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 5.0e-10 Identity = 30/35 (85.71%), Postives = 30/35 (85.71%), Query Frame = 1
BLAST of MELO3C016702 vs. TrEMBL
Match: A0A0A0L4Q7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G637710 PE=3 SV=1) HSP 1 Score: 191.4 bits (485), Expect = 8.8e-46 Identity = 94/101 (93.07%), Postives = 96/101 (95.05%), Query Frame = 1
BLAST of MELO3C016702 vs. TrEMBL
Match: G7LDQ8_MEDTR (Translation initiation factor IF-1 OS=Medicago truncatula GN=MTR_8g061130 PE=3 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 1.4e-11 Identity = 50/92 (54.35%), Postives = 55/92 (59.78%), Query Frame = 1
BLAST of MELO3C016702 vs. TrEMBL
Match: A0A067LED1_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_00251 PE=3 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 2.4e-11 Identity = 46/89 (51.69%), Postives = 56/89 (62.92%), Query Frame = 1
BLAST of MELO3C016702 vs. TrEMBL
Match: A0A0L9TRQ0_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan01g272200 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 9.2e-11 Identity = 48/99 (48.48%), Postives = 55/99 (55.56%), Query Frame = 1
BLAST of MELO3C016702 vs. TrEMBL
Match: A0A0S3R775_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.01G452400 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 9.2e-11 Identity = 48/99 (48.48%), Postives = 55/99 (55.56%), Query Frame = 1
BLAST of MELO3C016702 vs. NCBI nr
Match: gi|659103075|ref|XP_008452461.1| (PREDICTED: translation initiation factor IF-1, chloroplastic [Cucumis melo]) HSP 1 Score: 205.3 bits (521), Expect = 8.5e-50 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 1
BLAST of MELO3C016702 vs. NCBI nr
Match: gi|778695943|ref|XP_011654076.1| (PREDICTED: translation initiation factor IF-1, chloroplastic [Cucumis sativus]) HSP 1 Score: 191.4 bits (485), Expect = 1.3e-45 Identity = 94/101 (93.07%), Postives = 96/101 (95.05%), Query Frame = 1
BLAST of MELO3C016702 vs. NCBI nr
Match: gi|502183724|ref|XP_004517199.1| (PREDICTED: translation initiation factor IF-1, chloroplastic [Cicer arietinum]) HSP 1 Score: 79.3 bits (194), Expect = 7.0e-12 Identity = 49/92 (53.26%), Postives = 56/92 (60.87%), Query Frame = 1
BLAST of MELO3C016702 vs. NCBI nr
Match: gi|357516503|ref|XP_003628540.1| (translation initiation factor IF-1 [Medicago truncatula]) HSP 1 Score: 77.8 bits (190), Expect = 2.0e-11 Identity = 50/92 (54.35%), Postives = 55/92 (59.78%), Query Frame = 1
BLAST of MELO3C016702 vs. NCBI nr
Match: gi|802563043|ref|XP_012066685.1| (PREDICTED: translation initiation factor IF-1, chloroplastic [Jatropha curcas]) HSP 1 Score: 77.0 bits (188), Expect = 3.5e-11 Identity = 46/89 (51.69%), Postives = 56/89 (62.92%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|