MELO3C016684.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTACAGGTAACTATGATCTTCAATGAGGTCCTGAAGTTATACCCACCAACAAATATGTTTGGTGGCATTGTTAGGAATGCACACGAATTCAATCCAGAGAGATTTTCTGAAGGAGTTTCTAAAGCAACAAAAAATCCAAATGCTTTTATACCATTTGGATGGGGTCCTAGAATATGCATAGGACAAAACTTTGCCATGATTGAAGCAAAAATGGCATTATCAATGATCCCACAACACTTCTCATTTGAGCTTTCACCATCATACACACGCTCCCATTGCTACCTTAACAATACAGCCTCAACATGGAGCTCATATCATACTACACAAACTCTAGTTACCTTCTTAAACTATATATTATTAGCTTGCACATTATCAAAAGGCTAG ATGGTACAGGTAACTATGATCTTCAATGAGGTCCTGAAGTTATACCCACCAACAAATATGTTTGGTGGCATTGTTAGGAATGCACACGAATTCAATCCAGAGAGATTTTCTGAAGGAGTTTCTAAAGCAACAAAAAATCCAAATGCTTTTATACCATTTGGATGGGGTCCTAGAATATGCATAGGACAAAACTTTGCCATGATTGAAGCAAAAATGGCATTATCAATGATCCCACAACACTTCTCATTTGAGCTTTCACCATCATACACACGCTCCCATTGCTACCTTAACAATACAGCCTCAACATGGAGCTCATATCATACTACACAAACTCTAGTTACCTTCTTAAACTATATATTATTAGCTTGCACATTATCAAAAGGCTAG ATGGTACAGGTAACTATGATCTTCAATGAGGTCCTGAAGTTATACCCACCAACAAATATGTTTGGTGGCATTGTTAGGAATGCACACGAATTCAATCCAGAGAGATTTTCTGAAGGAGTTTCTAAAGCAACAAAAAATCCAAATGCTTTTATACCATTTGGATGGGGTCCTAGAATATGCATAGGACAAAACTTTGCCATGATTGAAGCAAAAATGGCATTATCAATGATCCCACAACACTTCTCATTTGAGCTTTCACCATCATACACACGCTCCCATTGCTACCTTAACAATACAGCCTCAACATGGAGCTCATATCATACTACACAAACTCTAGTTACCTTCTTAAACTATATATTATTAGCTTGCACATTATCAAAAGGCTAG MVQVTMIFNEVLKLYPPTNMFGGIVRNAHEFNPERFSEGVSKATKNPNAFIPFGWGPRICIGQNFAMIEAKMALSMIPQHFSFELSPSYTRSHCYLNNTASTWSSYHTTQTLVTFLNYILLACTLSKG
BLAST of MELO3C016684.2 vs. NCBI nr
Match: XP_008452438.1 (PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]) HSP 1 Score: 149.4 bits (376), Expect = 8.1e-33 Identity = 77/121 (63.64%), Postives = 84/121 (69.42%), Query Frame = 0
BLAST of MELO3C016684.2 vs. NCBI nr
Match: XP_004146006.2 (PREDICTED: cytochrome P450 CYP72A219-like [Cucumis sativus]) HSP 1 Score: 143.3 bits (360), Expect = 5.8e-31 Identity = 75/121 (61.98%), Postives = 80/121 (66.12%), Query Frame = 0
BLAST of MELO3C016684.2 vs. NCBI nr
Match: XP_011654406.1 (PREDICTED: cytochrome P450 CYP72A219-like [Cucumis sativus]) HSP 1 Score: 142.1 bits (357), Expect = 1.3e-30 Identity = 76/121 (62.81%), Postives = 80/121 (66.12%), Query Frame = 0
BLAST of MELO3C016684.2 vs. NCBI nr
Match: XP_011654016.1 (PREDICTED: cytochrome P450 CYP72A219-like [Cucumis sativus]) HSP 1 Score: 140.6 bits (353), Expect = 3.8e-30 Identity = 76/121 (62.81%), Postives = 81/121 (66.94%), Query Frame = 0
BLAST of MELO3C016684.2 vs. NCBI nr
Match: XP_011654017.1 (PREDICTED: cytochrome P450 CYP72A219 isoform X2 [Cucumis sativus]) HSP 1 Score: 136.7 bits (343), Expect = 5.4e-29 Identity = 71/121 (58.68%), Postives = 79/121 (65.29%), Query Frame = 0
BLAST of MELO3C016684.2 vs. TAIR10
Match: AT3G14620.1 (cytochrome P450, family 72, subfamily A, polypeptide 8) HSP 1 Score: 114.0 bits (284), Expect = 6.8e-26 Identity = 59/122 (48.36%), Postives = 73/122 (59.84%), Query Frame = 0
BLAST of MELO3C016684.2 vs. TAIR10
Match: AT3G14610.1 (cytochrome P450, family 72, subfamily A, polypeptide 7) HSP 1 Score: 112.8 bits (281), Expect = 1.5e-25 Identity = 59/121 (48.76%), Postives = 72/121 (59.50%), Query Frame = 0
BLAST of MELO3C016684.2 vs. TAIR10
Match: AT3G14630.1 (cytochrome P450, family 72, subfamily A, polypeptide 9) HSP 1 Score: 108.6 bits (270), Expect = 2.9e-24 Identity = 51/82 (62.20%), Postives = 64/82 (78.05%), Query Frame = 0
BLAST of MELO3C016684.2 vs. TAIR10
Match: AT3G14680.1 (cytochrome P450, family 72, subfamily A, polypeptide 14) HSP 1 Score: 105.1 bits (261), Expect = 3.2e-23 Identity = 57/121 (47.11%), Postives = 70/121 (57.85%), Query Frame = 0
BLAST of MELO3C016684.2 vs. TAIR10
Match: AT3G14690.1 (cytochrome P450, family 72, subfamily A, polypeptide 15) HSP 1 Score: 103.2 bits (256), Expect = 1.2e-22 Identity = 54/121 (44.63%), Postives = 71/121 (58.68%), Query Frame = 0
BLAST of MELO3C016684.2 vs. Swiss-Prot
Match: sp|Q9LUC6|C7A14_ARATH (Cytochrome P450 72A14 OS=Arabidopsis thaliana OX=3702 GN=CYP72A14 PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 5.7e-22 Identity = 57/121 (47.11%), Postives = 70/121 (57.85%), Query Frame = 0
BLAST of MELO3C016684.2 vs. Swiss-Prot
Match: sp|H1A988|C7254_GLYUR (11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis OX=74613 GN=CYP72A154 PE=1 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 1.3e-21 Identity = 54/118 (45.76%), Postives = 69/118 (58.47%), Query Frame = 0
BLAST of MELO3C016684.2 vs. Swiss-Prot
Match: sp|H1A981|C7263_MEDTR (11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula OX=3880 GN=CYP72A63 PE=1 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 1.3e-21 Identity = 53/118 (44.92%), Postives = 71/118 (60.17%), Query Frame = 0
BLAST of MELO3C016684.2 vs. Swiss-Prot
Match: sp|Q9LUC9|C7A11_ARATH (Cytochrome P450 72A11 OS=Arabidopsis thaliana OX=3702 GN=CYP72A11 PE=2 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.2e-21 Identity = 56/121 (46.28%), Postives = 71/121 (58.68%), Query Frame = 0
BLAST of MELO3C016684.2 vs. Swiss-Prot
Match: sp|Q9LUC5|C7A15_ARATH (Cytochrome P450 72A15 OS=Arabidopsis thaliana OX=3702 GN=CYP72A15 PE=2 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.2e-21 Identity = 54/121 (44.63%), Postives = 71/121 (58.68%), Query Frame = 0
BLAST of MELO3C016684.2 vs. TrEMBL
Match: tr|A0A1S3BTS9|A0A1S3BTS9_CUCME (cytochrome P450 CYP72A219-like OS=Cucumis melo OX=3656 GN=LOC103493473 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 5.3e-33 Identity = 77/121 (63.64%), Postives = 84/121 (69.42%), Query Frame = 0
BLAST of MELO3C016684.2 vs. TrEMBL
Match: tr|A0A1S3BTV3|A0A1S3BTV3_CUCME (cytochrome P450 CYP72A219-like OS=Cucumis melo OX=3656 GN=LOC103493472 PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 1.4e-28 Identity = 71/121 (58.68%), Postives = 80/121 (66.12%), Query Frame = 0
BLAST of MELO3C016684.2 vs. TrEMBL
Match: tr|A0A1S3BT76|A0A1S3BT76_CUCME (cytochrome P450 CYP72A219-like OS=Cucumis melo OX=3656 GN=LOC103493471 PE=3 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 4.8e-26 Identity = 67/121 (55.37%), Postives = 74/121 (61.16%), Query Frame = 0
BLAST of MELO3C016684.2 vs. TrEMBL
Match: tr|A0A1S3BQL9|A0A1S3BQL9_CUCME (cytochrome P450 CYP72A219-like OS=Cucumis melo OX=3656 GN=LOC103492242 PE=3 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 2.4e-25 Identity = 69/122 (56.56%), Postives = 77/122 (63.11%), Query Frame = 0
BLAST of MELO3C016684.2 vs. TrEMBL
Match: tr|A0A2P4ILA9|A0A2P4ILA9_QUESU (Cytochrome p450 OS=Quercus suber OX=58331 GN=CFP56_41125 PE=3 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 2.4e-25 Identity = 58/89 (65.17%), Postives = 70/89 (78.65%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|