MELO3C016684 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTACAGGTAACTATGATCTTCAATGAGGTCCTGAAGTTATACCCACCAACAAATATGTTTGGTGGCATTGTTAGGAATGCACACGAATTCAATCCAGAGAGATTTTCTGAAGGAGTTTCTAAAGCAACAAAAAATCCAAATGCTTTTATACCATTTGGATGGGGTCCTAGAATATGCATAGGACAAAACTTTGCCATGATTGAAGCAAAAATGGCATTATCAATGATCCCACAACACTTCTCATTTGAGCTTTCACCATCATACACACGCTCCCATTGCTACCTTAACAATACAGCCTCAACATGGAGCTCATATCATACTACACAAACTCTAGTTACCTTCTTAAACTATATATTATTAGCTTGCACATTATCAAAAGGCTAG ATGGTACAGGTAACTATGATCTTCAATGAGGTCCTGAAGTTATACCCACCAACAAATATGTTTGGTGGCATTGTTAGGAATGCACACGAATTCAATCCAGAGAGATTTTCTGAAGGAGTTTCTAAAGCAACAAAAAATCCAAATGCTTTTATACCATTTGGATGGGGTCCTAGAATATGCATAGGACAAAACTTTGCCATGATTGAAGCAAAAATGGCATTATCAATGATCCCACAACACTTCTCATTTGAGCTTTCACCATCATACACACGCTCCCATTGCTACCTTAACAATACAGCCTCAACATGGAGCTCATATCATACTACACAAACTCTAGTTACCTTCTTAAACTATATATTATTAGCTTGCACATTATCAAAAGGCTAG ATGGTACAGGTAACTATGATCTTCAATGAGGTCCTGAAGTTATACCCACCAACAAATATGTTTGGTGGCATTGTTAGGAATGCACACGAATTCAATCCAGAGAGATTTTCTGAAGGAGTTTCTAAAGCAACAAAAAATCCAAATGCTTTTATACCATTTGGATGGGGTCCTAGAATATGCATAGGACAAAACTTTGCCATGATTGAAGCAAAAATGGCATTATCAATGATCCCACAACACTTCTCATTTGAGCTTTCACCATCATACACACGCTCCCATTGCTACCTTAACAATACAGCCTCAACATGGAGCTCATATCATACTACACAAACTCTAGTTACCTTCTTAAACTATATATTATTAGCTTGCACATTATCAAAAGGCTAG MVQVTMIFNEVLKLYPPTNMFGGIVRNAHEFNPERFSEGVSKATKNPNAFIPFGWGPRICIGQNFAMIEAKMALSMIPQHFSFELSPSYTRSHCYLNNTASTWSSYHTTQTLVTFLNYILLACTLSKG*
BLAST of MELO3C016684 vs. Swiss-Prot
Match: C7A14_ARATH (Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 9.7e-22 Identity = 57/121 (47.11%), Postives = 68/121 (56.20%), Query Frame = 1
BLAST of MELO3C016684 vs. Swiss-Prot
Match: C7254_GLYUR (11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.8e-21 Identity = 54/118 (45.76%), Postives = 67/118 (56.78%), Query Frame = 1
BLAST of MELO3C016684 vs. Swiss-Prot
Match: C7263_MEDTR (11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.8e-21 Identity = 53/118 (44.92%), Postives = 70/118 (59.32%), Query Frame = 1
BLAST of MELO3C016684 vs. Swiss-Prot
Match: C7A15_ARATH (Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.7e-21 Identity = 54/121 (44.63%), Postives = 69/121 (57.02%), Query Frame = 1
BLAST of MELO3C016684 vs. Swiss-Prot
Match: C7A11_ARATH (Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.7e-21 Identity = 56/121 (46.28%), Postives = 68/121 (56.20%), Query Frame = 1
BLAST of MELO3C016684 vs. TrEMBL
Match: C9E9F0_CUCSA (Cytochrome p450 monoxygenase (Fragment) OS=Cucumis sativus GN=CYP PE=2 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 5.0e-25 Identity = 66/122 (54.10%), Postives = 77/122 (63.11%), Query Frame = 1
BLAST of MELO3C016684 vs. TrEMBL
Match: A0A024FC07_9POAL (Cytochrome P450 (Fragment) OS=Echinochloa phyllopogon GN=CYP72A256v2 PE=2 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 8.5e-25 Identity = 65/121 (53.72%), Postives = 76/121 (62.81%), Query Frame = 1
BLAST of MELO3C016684 vs. TrEMBL
Match: A0A0V0IFP4_SOLCH (Putative secologanin synthase-like OS=Solanum chacoense PE=3 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 2.5e-24 Identity = 64/121 (52.89%), Postives = 76/121 (62.81%), Query Frame = 1
BLAST of MELO3C016684 vs. TrEMBL
Match: F6I501_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_19s0015g02440 PE=3 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 3.2e-24 Identity = 64/121 (52.89%), Postives = 74/121 (61.16%), Query Frame = 1
BLAST of MELO3C016684 vs. TrEMBL
Match: F6I4Y3_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_19s0015g02090 PE=3 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 4.2e-24 Identity = 63/121 (52.07%), Postives = 76/121 (62.81%), Query Frame = 1
BLAST of MELO3C016684 vs. TAIR10
Match: AT3G14620.1 (AT3G14620.1 cytochrome P450, family 72, subfamily A, polypeptide 8) HSP 1 Score: 113.2 bits (282), Expect = 1.2e-25 Identity = 59/122 (48.36%), Postives = 71/122 (58.20%), Query Frame = 1
BLAST of MELO3C016684 vs. TAIR10
Match: AT3G14610.1 (AT3G14610.1 cytochrome P450, family 72, subfamily A, polypeptide 7) HSP 1 Score: 112.1 bits (279), Expect = 2.6e-25 Identity = 59/121 (48.76%), Postives = 70/121 (57.85%), Query Frame = 1
BLAST of MELO3C016684 vs. TAIR10
Match: AT3G14630.1 (AT3G14630.1 cytochrome P450, family 72, subfamily A, polypeptide 9) HSP 1 Score: 108.6 bits (270), Expect = 2.9e-24 Identity = 60/121 (49.59%), Postives = 70/121 (57.85%), Query Frame = 1
BLAST of MELO3C016684 vs. TAIR10
Match: AT3G14680.1 (AT3G14680.1 cytochrome P450, family 72, subfamily A, polypeptide 14) HSP 1 Score: 104.4 bits (259), Expect = 5.4e-23 Identity = 57/121 (47.11%), Postives = 68/121 (56.20%), Query Frame = 1
BLAST of MELO3C016684 vs. TAIR10
Match: AT3G14690.1 (AT3G14690.1 cytochrome P450, family 72, subfamily A, polypeptide 15) HSP 1 Score: 102.4 bits (254), Expect = 2.1e-22 Identity = 54/121 (44.63%), Postives = 69/121 (57.02%), Query Frame = 1
BLAST of MELO3C016684 vs. NCBI nr
Match: gi|659103032|ref|XP_008452438.1| (PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]) HSP 1 Score: 148.7 bits (374), Expect = 7.1e-33 Identity = 77/121 (63.64%), Postives = 84/121 (69.42%), Query Frame = 1
BLAST of MELO3C016684 vs. NCBI nr
Match: gi|778695577|ref|XP_004146006.2| (PREDICTED: cytochrome P450 CYP72A219-like [Cucumis sativus]) HSP 1 Score: 142.5 bits (358), Expect = 5.1e-31 Identity = 75/121 (61.98%), Postives = 80/121 (66.12%), Query Frame = 1
BLAST of MELO3C016684 vs. NCBI nr
Match: gi|778697794|ref|XP_011654406.1| (PREDICTED: cytochrome P450 CYP72A219-like [Cucumis sativus]) HSP 1 Score: 141.4 bits (355), Expect = 1.1e-30 Identity = 76/121 (62.81%), Postives = 80/121 (66.12%), Query Frame = 1
BLAST of MELO3C016684 vs. NCBI nr
Match: gi|778695562|ref|XP_011654016.1| (PREDICTED: cytochrome P450 CYP72A219-like [Cucumis sativus]) HSP 1 Score: 139.8 bits (351), Expect = 3.3e-30 Identity = 76/121 (62.81%), Postives = 81/121 (66.94%), Query Frame = 1
BLAST of MELO3C016684 vs. NCBI nr
Match: gi|778695569|ref|XP_011654017.1| (PREDICTED: cytochrome P450 CYP72A219 isoform X2 [Cucumis sativus]) HSP 1 Score: 136.0 bits (341), Expect = 4.8e-29 Identity = 71/121 (58.68%), Postives = 79/121 (65.29%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|