MELO3C016572 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTAGTTTATGAGTACATGCCAAACAAAAGTTTGGACTTCTTGTTATTTGGTAAAAATCTCTCAACTCTTTAAATTTACCTAGTTTGTCCTCTATTAAATAAAAGCCTATTACATTTTGATCAAAACGTTAATCTTACACCTTCAACATAACATGGTTGGATCGAGTAAGTTTGAAATCGACAGATGAAAGGCAACATCAACTATTAAACTGGTCGCAACAACACCACATTGTCGATCTGCGGAATTGCAAGAGGACTCCTTTTATCTTCATCAAGATTCTAGATTGA ATGCTAGTTTATGAGTACATGCCAAACAAAAGTTTGGACTTCTTGTTATTTGATGAAAGGCAACATCAACTATTAAACTGGTCGCAACAACACCACATTGTCGATCTGCGGAATTGCAAGAGGACTCCTTTTATCTTCATCAAGATTCTAGATTGA ATGCTAGTTTATGAGTACATGCCAAACAAAAGTTTGGACTTCTTGTTATTTGATGAAAGGCAACATCAACTATTAAACTGGTCGCAACAACACCACATTGTCGATCTGCGGAATTGCAAGAGGACTCCTTTTATCTTCATCAAGATTCTAGATTGA MLVYEYMPNKSLDFLLFDERQHQLLNWSQQHHIVDLRNCKRTPFIFIKILD*
BLAST of MELO3C016572 vs. Swiss-Prot
Match: CRK42_ARATH (Cysteine-rich receptor-like protein kinase 42 OS=Arabidopsis thaliana GN=CRK42 PE=2 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 3.9e-06 Identity = 22/34 (64.71%), Postives = 27/34 (79.41%), Query Frame = 1
BLAST of MELO3C016572 vs. Swiss-Prot
Match: SD11_ARATH (G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1 OS=Arabidopsis thaliana GN=SD11 PE=1 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 6.7e-06 Identity = 20/35 (57.14%), Postives = 27/35 (77.14%), Query Frame = 1
BLAST of MELO3C016572 vs. Swiss-Prot
Match: B120_ARATH (G-type lectin S-receptor-like serine/threonine-protein kinase B120 OS=Arabidopsis thaliana GN=B120 PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 6.7e-06 Identity = 21/35 (60.00%), Postives = 25/35 (71.43%), Query Frame = 1
BLAST of MELO3C016572 vs. TrEMBL
Match: A0A067L4F6_JATCU (Serine/threonine-protein kinase OS=Jatropha curcas GN=JCGZ_00736 PE=3 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 6.1e-06 Identity = 21/35 (60.00%), Postives = 31/35 (88.57%), Query Frame = 1
BLAST of MELO3C016572 vs. TAIR10
Match: AT5G40380.1 (AT5G40380.1 cysteine-rich RLK (RECEPTOR-like protein kinase) 42) HSP 1 Score: 51.2 bits (121), Expect = 2.2e-07 Identity = 22/34 (64.71%), Postives = 27/34 (79.41%), Query Frame = 1
BLAST of MELO3C016572 vs. TAIR10
Match: AT4G27300.1 (AT4G27300.1 S-locus lectin protein kinase family protein) HSP 1 Score: 50.4 bits (119), Expect = 3.8e-07 Identity = 20/35 (57.14%), Postives = 27/35 (77.14%), Query Frame = 1
BLAST of MELO3C016572 vs. TAIR10
Match: AT4G21390.1 (AT4G21390.1 S-locus lectin protein kinase family protein) HSP 1 Score: 50.4 bits (119), Expect = 3.8e-07 Identity = 21/35 (60.00%), Postives = 25/35 (71.43%), Query Frame = 1
BLAST of MELO3C016572 vs. TAIR10
Match: AT1G11300.1 (AT1G11300.1 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding) HSP 1 Score: 47.4 bits (111), Expect = 3.2e-06 Identity = 19/35 (54.29%), Postives = 26/35 (74.29%), Query Frame = 1
HSP 2 Score: 47.0 bits (110), Expect = 4.2e-06 Identity = 19/35 (54.29%), Postives = 26/35 (74.29%), Query Frame = 1
BLAST of MELO3C016572 vs. TAIR10
Match: AT4G23240.1 (AT4G23240.1 cysteine-rich RLK (RECEPTOR-like protein kinase) 16) HSP 1 Score: 47.4 bits (111), Expect = 3.2e-06 Identity = 19/34 (55.88%), Postives = 25/34 (73.53%), Query Frame = 1
BLAST of MELO3C016572 vs. NCBI nr
Match: gi|778688389|ref|XP_011652740.1| (PREDICTED: uncharacterized protein LOC101210952 [Cucumis sativus]) HSP 1 Score: 60.5 bits (145), Expect = 1.0e-06 Identity = 25/34 (73.53%), Postives = 30/34 (88.24%), Query Frame = 1
BLAST of MELO3C016572 vs. NCBI nr
Match: gi|778688389|ref|XP_011652740.1| (PREDICTED: uncharacterized protein LOC101210952 [Cucumis sativus]) HSP 1 Score: 53.9 bits (128), Expect = 9.6e-05 Identity = 22/34 (64.71%), Postives = 29/34 (85.29%), Query Frame = 1
HSP 2 Score: 60.5 bits (145), Expect = 1.0e-06 Identity = 25/34 (73.53%), Postives = 30/34 (88.24%), Query Frame = 1
BLAST of MELO3C016572 vs. NCBI nr
Match: gi|802586659|ref|XP_012070692.1| (PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Jatropha curcas]) HSP 1 Score: 57.4 bits (137), Expect = 8.7e-06 Identity = 21/35 (60.00%), Postives = 31/35 (88.57%), Query Frame = 1
BLAST of MELO3C016572 vs. NCBI nr
Match: gi|659102788|ref|XP_008452314.1| (PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Cucumis melo]) HSP 1 Score: 57.4 bits (137), Expect = 8.7e-06 Identity = 24/34 (70.59%), Postives = 29/34 (85.29%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |