MELO3C016559 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATGTGGTGTTGTTTGTTGTGTGCATCCCTCTTCCGCTTGTGGATGAGAAAAAGAAAGTCATTGGAGATGTTGACAAGGATCGAAGGTATGTGACTTGACCATGAGATACGTGAACTTGAAGTAAGGACATGCATCGTTCTGAGCTTTGTAAGAGATCAAGAAATCTTCGAAAATCGTTTAGAGCTTTGATAGACATAGGGTATGTGACTTCCATCAACGCTCGGTGCAATTCATAACATTTGTATACTTCTACCCTTTTTTGAAGTGTATTTTTGTGTGTACGCTCTCAAGGAAGCTTTTGAAGTTTTTTGCAATAAGGGTGTTGCTAGAAGTTCTAGTATAGAATTTCTTGTTACCTTTTGTGATAACATCCTTAAGAAAAGTGAGAGAGAGAAGTTGAGTGATAAAAAAATCAAGGAGACACTTGAGAAGGTAATTTTTCTATTTATTAATCATTTGAAGTTCATTTAGTGTTGTAACTTTGGATTTCATATGATTTAAAAATACAGGTTGTGAAGTTGTTAGCATACATTGACAAAGATCTGTTTGCTGAATTCTATAGGTGA ATGAATGTGGTGTTGTTTGTTGTGTGCATCCCTCTTCCGCTTGTGGATGAGAAAAAGAAAGTCATTGGAGATGTTGACAAGGATCGAAGGTATGAAGCTTTTGAAGTTTTTTGCAATAAGGGTGTTGCTAGAAGTTCTAGTATAGAATTTCTTGTTACCTTTTGTGATAACATCCTTAAGAAAAGTGAGAGAGAGAAGTTGAGTGATAAAAAAATCAAGGAGACACTTGAGAAGGTTGTGAAGTTGTTAGCATACATTGACAAAGATCTGTTTGCTGAATTCTATAGGTGA ATGAATGTGGTGTTGTTTGTTGTGTGCATCCCTCTTCCGCTTGTGGATGAGAAAAAGAAAGTCATTGGAGATGTTGACAAGGATCGAAGGTATGAAGCTTTTGAAGTTTTTTGCAATAAGGGTGTTGCTAGAAGTTCTAGTATAGAATTTCTTGTTACCTTTTGTGATAACATCCTTAAGAAAAGTGAGAGAGAGAAGTTGAGTGATAAAAAAATCAAGGAGACACTTGAGAAGGTTGTGAAGTTGTTAGCATACATTGACAAAGATCTGTTTGCTGAATTCTATAGGTGA MNVVLFVVCIPLPLVDEKKKVIGDVDKDRRYEAFEVFCNKGVARSSSIEFLVTFCDNILKKSEREKLSDKKIKETLEKVVKLLAYIDKDLFAEFYR*
BLAST of MELO3C016559 vs. Swiss-Prot
Match: CUL1_ARATH (Cullin-1 OS=Arabidopsis thaliana GN=CUL1 PE=1 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.4e-20 Identity = 52/66 (78.79%), Postives = 54/66 (81.82%), Query Frame = 1
HSP 2 Score: 41.2 bits (95), Expect = 7.6e-03 Identity = 18/22 (81.82%), Postives = 18/22 (81.82%), Query Frame = 1
BLAST of MELO3C016559 vs. Swiss-Prot
Match: CLL1_ARATH (Putative cullin-like protein 1 OS=Arabidopsis thaliana GN=At1g43140 PE=3 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 4.6e-16 Identity = 47/67 (70.15%), Postives = 50/67 (74.63%), Query Frame = 1
HSP 2 Score: 41.2 bits (95), Expect = 7.6e-03 Identity = 28/83 (33.73%), Postives = 44/83 (53.01%), Query Frame = 1
BLAST of MELO3C016559 vs. Swiss-Prot
Match: CUL2_ARATH (Cullin-2 OS=Arabidopsis thaliana GN=CUL2 PE=1 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.1e-14 Identity = 45/67 (67.16%), Postives = 49/67 (73.13%), Query Frame = 1
HSP 2 Score: 40.8 bits (94), Expect = 9.9e-03 Identity = 27/83 (32.53%), Postives = 44/83 (53.01%), Query Frame = 1
BLAST of MELO3C016559 vs. TrEMBL
Match: Q711G6_TOBAC (Cullin 1C (Fragment) OS=Nicotiana tabacum GN=cul1C PE=2 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 6.2e-20 Identity = 55/66 (83.33%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of MELO3C016559 vs. TrEMBL
Match: Q711G6_TOBAC (Cullin 1C (Fragment) OS=Nicotiana tabacum GN=cul1C PE=2 SV=1) HSP 1 Score: 40.4 bits (93), Expect = 1.4e+00 Identity = 19/22 (86.36%), Postives = 19/22 (86.36%), Query Frame = 1
HSP 2 Score: 104.8 bits (260), Expect = 6.2e-20 Identity = 55/66 (83.33%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of MELO3C016559 vs. TrEMBL
Match: A0A0A0KCC8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G197230 PE=3 SV=1) HSP 1 Score: 42.7 bits (99), Expect = 2.9e-01 Identity = 20/22 (90.91%), Postives = 20/22 (90.91%), Query Frame = 1
HSP 2 Score: 104.8 bits (260), Expect = 6.2e-20 Identity = 55/66 (83.33%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of MELO3C016559 vs. TrEMBL
Match: W9RHF4_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_023551 PE=3 SV=1) HSP 1 Score: 42.7 bits (99), Expect = 2.9e-01 Identity = 20/22 (90.91%), Postives = 20/22 (90.91%), Query Frame = 1
HSP 2 Score: 104.8 bits (260), Expect = 6.2e-20 Identity = 55/66 (83.33%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of MELO3C016559 vs. TrEMBL
Match: V4RG42_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10004406mg PE=3 SV=1) HSP 1 Score: 42.7 bits (99), Expect = 2.9e-01 Identity = 20/22 (90.91%), Postives = 20/22 (90.91%), Query Frame = 1
HSP 2 Score: 104.8 bits (260), Expect = 6.2e-20 Identity = 55/66 (83.33%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of MELO3C016559 vs. TAIR10
Match: AT4G02570.1 (AT4G02570.1 cullin 1) HSP 1 Score: 100.1 bits (248), Expect = 7.7e-22 Identity = 52/66 (78.79%), Postives = 54/66 (81.82%), Query Frame = 1
HSP 2 Score: 41.2 bits (95), Expect = 4.3e-04 Identity = 18/22 (81.82%), Postives = 18/22 (81.82%), Query Frame = 1
BLAST of MELO3C016559 vs. TAIR10
Match: AT1G43140.1 (AT1G43140.1 Cullin family protein) HSP 1 Score: 85.1 bits (209), Expect = 2.6e-17 Identity = 47/67 (70.15%), Postives = 50/67 (74.63%), Query Frame = 1
HSP 2 Score: 41.2 bits (95), Expect = 4.3e-04 Identity = 28/83 (33.73%), Postives = 44/83 (53.01%), Query Frame = 1
BLAST of MELO3C016559 vs. TAIR10
Match: AT1G02980.1 (AT1G02980.1 cullin 2) HSP 1 Score: 80.5 bits (197), Expect = 6.3e-16 Identity = 45/67 (67.16%), Postives = 49/67 (73.13%), Query Frame = 1
HSP 2 Score: 40.8 bits (94), Expect = 5.6e-04 Identity = 27/83 (32.53%), Postives = 44/83 (53.01%), Query Frame = 1
BLAST of MELO3C016559 vs. NCBI nr
Match: gi|703105670|ref|XP_010098303.1| (hypothetical protein L484_023551 [Morus notabilis]) HSP 1 Score: 104.8 bits (260), Expect = 8.9e-20 Identity = 55/66 (83.33%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of MELO3C016559 vs. NCBI nr
Match: gi|703105670|ref|XP_010098303.1| (hypothetical protein L484_023551 [Morus notabilis]) HSP 1 Score: 42.7 bits (99), Expect = 4.1e-01 Identity = 20/22 (90.91%), Postives = 20/22 (90.91%), Query Frame = 1
HSP 2 Score: 104.8 bits (260), Expect = 8.9e-20 Identity = 55/66 (83.33%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of MELO3C016559 vs. NCBI nr
Match: gi|449450670|ref|XP_004143085.1| (PREDICTED: cullin-1 [Cucumis sativus]) HSP 1 Score: 42.7 bits (99), Expect = 4.1e-01 Identity = 20/22 (90.91%), Postives = 20/22 (90.91%), Query Frame = 1
HSP 2 Score: 104.8 bits (260), Expect = 8.9e-20 Identity = 55/66 (83.33%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of MELO3C016559 vs. NCBI nr
Match: gi|672164483|ref|XP_008802119.1| (PREDICTED: cullin-1 [Phoenix dactylifera]) HSP 1 Score: 42.4 bits (98), Expect = 5.4e-01 Identity = 19/22 (86.36%), Postives = 20/22 (90.91%), Query Frame = 1
HSP 2 Score: 104.8 bits (260), Expect = 8.9e-20 Identity = 55/66 (83.33%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of MELO3C016559 vs. NCBI nr
Match: gi|34481803|emb|CAC87837.1| (cullin 1C [Nicotiana tabacum]) HSP 1 Score: 40.4 bits (93), Expect = 2.1e+00 Identity = 19/22 (86.36%), Postives = 19/22 (86.36%), Query Frame = 1
HSP 2 Score: 104.8 bits (260), Expect = 8.9e-20 Identity = 55/66 (83.33%), Postives = 57/66 (86.36%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |