MELO3C015163 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATTGGAAAAATCATGGGCATCCCTCATGCACCAAGATCATGCCGATTTTGCTAACATTCGCAATGCTCAATTTGATGGTTCAATATCTCTGCAGCGAAGACAACGTTTTAGACGGATGTGGCGTGTAAGAGAACATATGGCATTCTTGATTAGAAATCTTCAGTTTTATATCCAG ATGGAATTGGAAAAATCATGGGCATCCCTCATGCACCAAGATCATGCCGATTTTGCTAACATTCGCAATGCTCAATTTGATGGTTCAATATCTCTGCAGCGAAGACAACGTTTTAGACGGATGTGGCGTGTAAGAGAACATATGGCATTCTTGATTAGAAATCTTCAGTTTTATATCCAG ATGGAATTGGAAAAATCATGGGCATCCCTCATGCACCAAGATCATGCCGATTTTGCTAACATTCGCAATGCTCAATTTGATGGTTCAATATCTCTGCAGCGAAGACAACGTTTTAGACGGATGTGGCGTGTAAGAGAACATATGGCATTCTTGATTAGAAATCTTCAGTTTTATATCCAG MELEKSWASLMHQDHADFANIRNAQFDGSISLQRRQRFRRMWRVREHMAFLIRNLQFYIQ
BLAST of MELO3C015163 vs. Swiss-Prot
Match: GACP4_ARATH (Gamma-tubulin complex component 4 OS=Arabidopsis thaliana GN=GCP4 PE=2 SV=2) HSP 1 Score: 90.1 bits (222), Expect = 8.8e-18 Identity = 44/60 (73.33%), Postives = 45/60 (75.00%), Query Frame = 1
BLAST of MELO3C015163 vs. Swiss-Prot
Match: GCP4_MEDTR (Gamma-tubulin complex component 4 homolog OS=Medicago truncatula GN=85P PE=2 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 8.2e-16 Identity = 43/61 (70.49%), Postives = 46/61 (75.41%), Query Frame = 1
BLAST of MELO3C015163 vs. TrEMBL
Match: A0A0A0LXP4_CUCSA (Gamma-tubulin complex component OS=Cucumis sativus GN=Csa_1G616260 PE=3 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 4.0e-25 Identity = 58/60 (96.67%), Postives = 58/60 (96.67%), Query Frame = 1
BLAST of MELO3C015163 vs. TrEMBL
Match: A0A164YZ83_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus GN=DCAR_018329 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.2e-18 Identity = 47/60 (78.33%), Postives = 51/60 (85.00%), Query Frame = 1
BLAST of MELO3C015163 vs. TrEMBL
Match: B9I9Q8_POPTR (Gamma-tubulin complex component OS=Populus trichocarpa GN=POPTR_0014s12310g PE=3 SV=2) HSP 1 Score: 99.8 bits (247), Expect = 1.2e-18 Identity = 47/60 (78.33%), Postives = 51/60 (85.00%), Query Frame = 1
BLAST of MELO3C015163 vs. TrEMBL
Match: A0A022S453_ERYGU (Gamma-tubulin complex component OS=Erythranthe guttata GN=MIMGU_mgv1a001863mg PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.2e-18 Identity = 48/60 (80.00%), Postives = 51/60 (85.00%), Query Frame = 1
BLAST of MELO3C015163 vs. TrEMBL
Match: A0A0J8C176_BETVU (Gamma-tubulin complex component OS=Beta vulgaris subsp. vulgaris GN=BVRB_7g163840 PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.2e-18 Identity = 48/60 (80.00%), Postives = 51/60 (85.00%), Query Frame = 1
BLAST of MELO3C015163 vs. TAIR10
Match: AT3G53760.1 (AT3G53760.1 GAMMA-TUBULIN COMPLEX PROTEIN 4) HSP 1 Score: 90.1 bits (222), Expect = 4.9e-19 Identity = 44/60 (73.33%), Postives = 45/60 (75.00%), Query Frame = 1
BLAST of MELO3C015163 vs. NCBI nr
Match: gi|659099014|ref|XP_008450390.1| (PREDICTED: gamma-tubulin complex component 4 homolog isoform X2 [Cucumis melo]) HSP 1 Score: 126.3 bits (316), Expect = 1.8e-26 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of MELO3C015163 vs. NCBI nr
Match: gi|659099008|ref|XP_008450387.1| (PREDICTED: gamma-tubulin complex component 4 homolog isoform X1 [Cucumis melo]) HSP 1 Score: 126.3 bits (316), Expect = 1.8e-26 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of MELO3C015163 vs. NCBI nr
Match: gi|659130829|ref|XP_008465374.1| (PREDICTED: gamma-tubulin complex component 4 homolog [Cucumis melo]) HSP 1 Score: 123.6 bits (309), Expect = 1.1e-25 Identity = 59/60 (98.33%), Postives = 59/60 (98.33%), Query Frame = 1
BLAST of MELO3C015163 vs. NCBI nr
Match: gi|778663742|ref|XP_011660150.1| (PREDICTED: gamma-tubulin complex component 4 homolog [Cucumis sativus]) HSP 1 Score: 121.3 bits (303), Expect = 5.7e-25 Identity = 58/60 (96.67%), Postives = 58/60 (96.67%), Query Frame = 1
BLAST of MELO3C015163 vs. NCBI nr
Match: gi|700211412|gb|KGN66508.1| (hypothetical protein Csa_1G616260 [Cucumis sativus]) HSP 1 Score: 121.3 bits (303), Expect = 5.7e-25 Identity = 58/60 (96.67%), Postives = 58/60 (96.67%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|