MELO3C014541 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGAATCATCATCCACTTCAAAGTCCGATTTGCAATTAGAAGAAATGCTGGATCGAATATTGACGCGCTTGGCTTTGTGCGACGACTCCAATCTTCAATCCCTTCTTTTGAAAGTTCTTCCTGCCACAATTTCATCCCTTTCTTCGCAGGCCATATCTGTCCGTAACAAGGTTTTGTAA ATGGCGGAATCATCATCCACTTCAAAGTCCGATTTGCAATTAGAAGAAATGCTGGATCGAATATTGACGCGCTTGGCTTTGTGCGACGACTCCAATCTTCAATCCCTTCTTTTGAAAGTTCTTCCTGCCACAATTTCATCCCTTTCTTCGCAGGCCATATCTGTCCGTAACAAGGTTTTGTAA ATGGCGGAATCATCATCCACTTCAAAGTCCGATTTGCAATTAGAAGAAATGCTGGATCGAATATTGACGCGCTTGGCTTTGTGCGACGACTCCAATCTTCAATCCCTTCTTTTGAAAGTTCTTCCTGCCACAATTTCATCCCTTTCTTCGCAGGCCATATCTGTCCGTAACAAGGTTTTGTAA MAESSSTSKSDLQLEEMLDRILTRLALCDDSNLQSLLLKVLPATISSLSSQAISVRNKVL*
BLAST of MELO3C014541 vs. TrEMBL
Match: A0A0A0KI82_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G429070 PE=4 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 4.2e-22 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of MELO3C014541 vs. TrEMBL
Match: G7KCU1_MEDTR (Proteasome-associated ECM29-like protein OS=Medicago truncatula GN=MTR_5g089000 PE=4 SV=2) HSP 1 Score: 83.6 bits (205), Expect = 9.3e-14 Identity = 46/66 (69.70%), Postives = 55/66 (83.33%), Query Frame = 1
BLAST of MELO3C014541 vs. TrEMBL
Match: I1M768_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=2) HSP 1 Score: 83.2 bits (204), Expect = 1.2e-13 Identity = 45/62 (72.58%), Postives = 54/62 (87.10%), Query Frame = 1
BLAST of MELO3C014541 vs. TrEMBL
Match: A0A0B2PNJ9_GLYSO (Proteasome-associated protein ECM29 like OS=Glycine soja GN=glysoja_047266 PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 1.2e-13 Identity = 45/62 (72.58%), Postives = 54/62 (87.10%), Query Frame = 1
BLAST of MELO3C014541 vs. TrEMBL
Match: A0A0R0G8R3_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_14G036800 PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 1.2e-13 Identity = 45/62 (72.58%), Postives = 54/62 (87.10%), Query Frame = 1
BLAST of MELO3C014541 vs. TAIR10
Match: AT2G26780.1 (AT2G26780.1 ARM repeat superfamily protein) HSP 1 Score: 79.3 bits (194), Expect = 8.9e-16 Identity = 42/59 (71.19%), Postives = 48/59 (81.36%), Query Frame = 1
BLAST of MELO3C014541 vs. NCBI nr
Match: gi|778716843|ref|XP_011657603.1| (PREDICTED: proteasome-associated protein ECM29 homolog isoform X2 [Cucumis sativus]) HSP 1 Score: 111.3 bits (277), Expect = 6.0e-22 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of MELO3C014541 vs. NCBI nr
Match: gi|778716846|ref|XP_011657604.1| (PREDICTED: proteasome-associated protein ECM29 homolog isoform X3 [Cucumis sativus]) HSP 1 Score: 111.3 bits (277), Expect = 6.0e-22 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of MELO3C014541 vs. NCBI nr
Match: gi|659097443|ref|XP_008449628.1| (PREDICTED: proteasome-associated protein ECM29 homolog isoform X2 [Cucumis melo]) HSP 1 Score: 111.3 bits (277), Expect = 6.0e-22 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of MELO3C014541 vs. NCBI nr
Match: gi|778716839|ref|XP_011657602.1| (PREDICTED: proteasome-associated protein ECM29 homolog isoform X1 [Cucumis sativus]) HSP 1 Score: 111.3 bits (277), Expect = 6.0e-22 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of MELO3C014541 vs. NCBI nr
Match: gi|659097440|ref|XP_008449627.1| (PREDICTED: proteasome-associated protein ECM29 homolog isoform X1 [Cucumis melo]) HSP 1 Score: 111.3 bits (277), Expect = 6.0e-22 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|