MELO3C014350 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCTCGCAATGTGCGGCTCTCACCTGAAGAAAGACAAAAGGTTCTCTTCAAATTATAGTGTAGTAGTGGCTTCAAAGTGCAAAGCACATTGGCTTTATCGTTCATGATCAAATGATTACTTAGATTCAGAAATTGCTTTGCTTCTTCTCTTTCGTCTATAGGCATTGTCAATAAACAGATCATTGTCAAAAGCAAAATCTGCAGCAGAACAAGGTGAACTCAATTGTAAAAGATTAAAAAACTTGGTTGTCGATGAAATACAAGAAGCTGGCGGAGAACTTGATTATGCTGAGGTGAGCCCTGGATGA ATGAGTTCTCGCAATGTGCGGCTCTCACCTGAAGAAAGACAAAAGGCATTGTCAATAAACAGATCATTGTCAAAAGCAAAATCTGCAGCAGAACAAGGTGAACTCAATTGTAAAAGATTAAAAAACTTGGTTGTCGATGAAATACAAGAAGCTGGCGGAGAACTTGATTATGCTGAGGTGAGCCCTGGATGA ATGAGTTCTCGCAATGTGCGGCTCTCACCTGAAGAAAGACAAAAGGCATTGTCAATAAACAGATCATTGTCAAAAGCAAAATCTGCAGCAGAACAAGGTGAACTCAATTGTAAAAGATTAAAAAACTTGGTTGTCGATGAAATACAAGAAGCTGGCGGAGAACTTGATTATGCTGAGGTGAGCCCTGGATGA MSSRNVRLSPEERQKALSINRSLSKAKSAAEQGELNCKRLKNLVVDEIQEAGGELDYAEVSPG*
BLAST of MELO3C014350 vs. Swiss-Prot
Match: PANC_LOTJA (Pantoate--beta-alanine ligase OS=Lotus japonicus GN=PANC PE=1 SV=3) HSP 1 Score: 85.9 bits (211), Expect = 1.8e-16 Identity = 41/60 (68.33%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of MELO3C014350 vs. Swiss-Prot
Match: PANC_ORYSJ (Pantoate--beta-alanine ligase OS=Oryza sativa subsp. japonica GN=PANC PE=2 SV=2) HSP 1 Score: 70.9 bits (172), Expect = 5.9e-12 Identity = 33/60 (55.00%), Postives = 44/60 (73.33%), Query Frame = 1
BLAST of MELO3C014350 vs. Swiss-Prot
Match: PANC_ARATH (Pantoate--beta-alanine ligase OS=Arabidopsis thaliana GN=At5g48840 PE=1 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 5.9e-12 Identity = 31/60 (51.67%), Postives = 46/60 (76.67%), Query Frame = 1
BLAST of MELO3C014350 vs. Swiss-Prot
Match: PANC_BACP2 (Pantothenate synthetase OS=Bacillus pumilus (strain SAFR-032) GN=panC PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 8.8e-08 Identity = 28/59 (47.46%), Postives = 39/59 (66.10%), Query Frame = 1
BLAST of MELO3C014350 vs. Swiss-Prot
Match: PANC_PELTS (Pantothenate synthetase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=panC PE=3 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 2.2e-06 Identity = 28/61 (45.90%), Postives = 38/61 (62.30%), Query Frame = 1
BLAST of MELO3C014350 vs. TrEMBL
Match: A0A0K9RMD2_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_056280 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.7e-16 Identity = 44/60 (73.33%), Postives = 55/60 (91.67%), Query Frame = 1
BLAST of MELO3C014350 vs. TrEMBL
Match: F6HZY6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_07s0005g05780 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.0e-15 Identity = 42/60 (70.00%), Postives = 53/60 (88.33%), Query Frame = 1
BLAST of MELO3C014350 vs. TrEMBL
Match: A0A059AVS4_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_H00804 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.0e-15 Identity = 42/60 (70.00%), Postives = 55/60 (91.67%), Query Frame = 1
BLAST of MELO3C014350 vs. TrEMBL
Match: A0A0L9TXQ5_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan02g152300 PE=3 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.0e-15 Identity = 43/60 (71.67%), Postives = 51/60 (85.00%), Query Frame = 1
BLAST of MELO3C014350 vs. TrEMBL
Match: A0A0S3SR21_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.08G190400 PE=3 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.0e-15 Identity = 43/60 (71.67%), Postives = 51/60 (85.00%), Query Frame = 1
BLAST of MELO3C014350 vs. TAIR10
Match: AT5G48840.1 (AT5G48840.1 homolog of bacterial PANC) HSP 1 Score: 70.9 bits (172), Expect = 3.3e-13 Identity = 31/60 (51.67%), Postives = 46/60 (76.67%), Query Frame = 1
BLAST of MELO3C014350 vs. NCBI nr
Match: gi|659130281|ref|XP_008465087.1| (PREDICTED: pantoate--beta-alanine ligase [Cucumis melo]) HSP 1 Score: 114.8 bits (286), Expect = 5.7e-23 Identity = 58/60 (96.67%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of MELO3C014350 vs. NCBI nr
Match: gi|778682111|ref|XP_004152022.2| (PREDICTED: LOW QUALITY PROTEIN: pantoate--beta-alanine ligase [Cucumis sativus]) HSP 1 Score: 111.3 bits (277), Expect = 6.3e-22 Identity = 56/60 (93.33%), Postives = 58/60 (96.67%), Query Frame = 1
BLAST of MELO3C014350 vs. NCBI nr
Match: gi|778716155|ref|XP_004140085.2| (PREDICTED: LOW QUALITY PROTEIN: pantoate--beta-alanine ligase-like [Cucumis sativus]) HSP 1 Score: 109.0 bits (271), Expect = 3.1e-21 Identity = 56/60 (93.33%), Postives = 57/60 (95.00%), Query Frame = 1
BLAST of MELO3C014350 vs. NCBI nr
Match: gi|694314496|ref|XP_009371408.1| (PREDICTED: LOW QUALITY PROTEIN: pantoate--beta-alanine ligase [Pyrus x bretschneideri]) HSP 1 Score: 92.4 bits (228), Expect = 3.0e-16 Identity = 43/60 (71.67%), Postives = 56/60 (93.33%), Query Frame = 1
BLAST of MELO3C014350 vs. NCBI nr
Match: gi|902225285|gb|KNA20017.1| (hypothetical protein SOVF_056280 [Spinacia oleracea]) HSP 1 Score: 91.3 bits (225), Expect = 6.7e-16 Identity = 44/60 (73.33%), Postives = 55/60 (91.67%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: None |