MELO3C012918 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCATGTTGTGGATATGGAGGGGCACCAAACAATTACAACGTAAAAGCAACATGTGGGCAACCAGGTTATTCTATTTGTTCAAATCCTTCAAAATCAATAATATGGGATGGTGTTCATTACACCGATGCTGCTAATCATCTTGTGGCTTCTTCCATCTTTTCTTCCCATTTCTCTACTCCTAAACTATCTCTTCACCAACTTTCCTCTCTTTAA ATGGCATGTTGTGGATATGGAGGGGCACCAAACAATTACAACGTAAAAGCAACATGTGGGCAACCAGGTTATTCTATTTGTTCAAATCCTTCAAAATCAATAATATGGGATGGTGTTCATTACACCGATGCTGCTAATCATCTTGTGGCTTCTTCCATCTTTTCTTCCCATTTCTCTACTCCTAAACTATCTCTTCACCAACTTTCCTCTCTTTAA ATGGCATGTTGTGGATATGGAGGGGCACCAAACAATTACAACGTAAAAGCAACATGTGGGCAACCAGGTTATTCTATTTGTTCAAATCCTTCAAAATCAATAATATGGGATGGTGTTCATTACACCGATGCTGCTAATCATCTTGTGGCTTCTTCCATCTTTTCTTCCCATTTCTCTACTCCTAAACTATCTCTTCACCAACTTTCCTCTCTTTAA MACCGYGGAPNNYNVKATCGQPGYSICSNPSKSIIWDGVHYTDAANHLVASSIFSSHFSTPKLSLHQLSSL*
BLAST of MELO3C012918 vs. Swiss-Prot
Match: GDL60_ARATH (GDSL esterase/lipase At3g62280 OS=Arabidopsis thaliana GN=At3g62280 PE=2 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 6.6e-20 Identity = 40/65 (61.54%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of MELO3C012918 vs. Swiss-Prot
Match: LIP4_ARATH (GDSL esterase/lipase LIP-4 OS=Arabidopsis thaliana GN=LIP4 PE=2 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.4e-17 Identity = 36/66 (54.55%), Postives = 42/66 (63.64%), Query Frame = 1
BLAST of MELO3C012918 vs. Swiss-Prot
Match: GDL2_ARATH (GDSL esterase/lipase At1g09390 OS=Arabidopsis thaliana GN=At1g09390 PE=2 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.2e-15 Identity = 35/66 (53.03%), Postives = 38/66 (57.58%), Query Frame = 1
BLAST of MELO3C012918 vs. Swiss-Prot
Match: GDL22_ARATH (GDSL esterase/lipase At1g54790 OS=Arabidopsis thaliana GN=At1g54790 PE=2 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.3e-12 Identity = 35/72 (48.61%), Postives = 44/72 (61.11%), Query Frame = 1
BLAST of MELO3C012918 vs. Swiss-Prot
Match: GDL16_ARATH (GDSL esterase/lipase At1g31550 OS=Arabidopsis thaliana GN=At1g31550 PE=2 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.6e-10 Identity = 29/70 (41.43%), Postives = 40/70 (57.14%), Query Frame = 1
BLAST of MELO3C012918 vs. TrEMBL
Match: A5AD17_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_025409 PE=4 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 9.9e-23 Identity = 48/68 (70.59%), Postives = 56/68 (82.35%), Query Frame = 1
BLAST of MELO3C012918 vs. TrEMBL
Match: D7U2N6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_07s0005g02050 PE=4 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 9.9e-23 Identity = 48/68 (70.59%), Postives = 56/68 (82.35%), Query Frame = 1
BLAST of MELO3C012918 vs. TrEMBL
Match: A0A061DSI4_THECC (GDSL-like Lipase/Acylhydrolase superfamily protein OS=Theobroma cacao GN=TCM_004890 PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 1.9e-21 Identity = 45/65 (69.23%), Postives = 57/65 (87.69%), Query Frame = 1
BLAST of MELO3C012918 vs. TrEMBL
Match: A0A0D2PC15_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G146200 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.3e-19 Identity = 42/65 (64.62%), Postives = 55/65 (84.62%), Query Frame = 1
BLAST of MELO3C012918 vs. TrEMBL
Match: R0HND2_9BRAS (Uncharacterized protein OS=Capsella rubella GN=CARUB_v10018750mg PE=4 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 3.9e-19 Identity = 41/65 (63.08%), Postives = 54/65 (83.08%), Query Frame = 1
BLAST of MELO3C012918 vs. TAIR10
Match: AT3G62280.1 (AT3G62280.1 GDSL-like Lipase/Acylhydrolase superfamily protein) HSP 1 Score: 97.4 bits (241), Expect = 3.7e-21 Identity = 40/65 (61.54%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of MELO3C012918 vs. TAIR10
Match: AT1G56670.1 (AT1G56670.1 GDSL-like Lipase/Acylhydrolase superfamily protein) HSP 1 Score: 89.7 bits (221), Expect = 7.7e-19 Identity = 36/66 (54.55%), Postives = 42/66 (63.64%), Query Frame = 1
BLAST of MELO3C012918 vs. TAIR10
Match: AT1G09390.1 (AT1G09390.1 GDSL-like Lipase/Acylhydrolase superfamily protein) HSP 1 Score: 82.4 bits (202), Expect = 1.2e-16 Identity = 35/66 (53.03%), Postives = 38/66 (57.58%), Query Frame = 1
BLAST of MELO3C012918 vs. TAIR10
Match: AT1G54790.2 (AT1G54790.2 GDSL-like Lipase/Acylhydrolase superfamily protein) HSP 1 Score: 72.4 bits (176), Expect = 1.3e-13 Identity = 35/72 (48.61%), Postives = 44/72 (61.11%), Query Frame = 1
BLAST of MELO3C012918 vs. TAIR10
Match: AT1G31550.2 (AT1G31550.2 GDSL-like Lipase/Acylhydrolase superfamily protein) HSP 1 Score: 66.2 bits (160), Expect = 9.2e-12 Identity = 29/70 (41.43%), Postives = 40/70 (57.14%), Query Frame = 1
BLAST of MELO3C012918 vs. NCBI nr
Match: gi|147786947|emb|CAN71136.1| (hypothetical protein VITISV_025409 [Vitis vinifera]) HSP 1 Score: 113.6 bits (283), Expect = 1.4e-22 Identity = 48/68 (70.59%), Postives = 56/68 (82.35%), Query Frame = 1
BLAST of MELO3C012918 vs. NCBI nr
Match: gi|359480202|ref|XP_002272542.2| (PREDICTED: GDSL esterase/lipase At3g62280 [Vitis vinifera]) HSP 1 Score: 113.6 bits (283), Expect = 1.4e-22 Identity = 48/68 (70.59%), Postives = 56/68 (82.35%), Query Frame = 1
BLAST of MELO3C012918 vs. NCBI nr
Match: gi|590720035|ref|XP_007051220.1| (GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma cacao]) HSP 1 Score: 109.4 bits (272), Expect = 2.7e-21 Identity = 45/65 (69.23%), Postives = 57/65 (87.69%), Query Frame = 1
BLAST of MELO3C012918 vs. NCBI nr
Match: gi|823150396|ref|XP_012475016.1| (PREDICTED: GDSL esterase/lipase At3g62280 [Gossypium raimondii]) HSP 1 Score: 103.2 bits (256), Expect = 1.9e-19 Identity = 42/65 (64.62%), Postives = 55/65 (84.62%), Query Frame = 1
BLAST of MELO3C012918 vs. NCBI nr
Match: gi|729425805|ref|XP_010559175.1| (PREDICTED: GDSL esterase/lipase At3g62280-like [Tarenaya hassleriana]) HSP 1 Score: 101.7 bits (252), Expect = 5.6e-19 Identity = 42/65 (64.62%), Postives = 54/65 (83.08%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|