MELO3C012882.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATTTTTTCTCCTGAAGGCCCTTGATAGAGTTGTTGCATTGTTGAAAGTAGTCAGGCTAGCCACGGGGCACAATGCAATTGATATGGTTGGAACAATTCTATTAAATATATTACGAGGTGATATTGCAAGGTATTTTAATAGTAAGACTTTTTTTTTCAATTACTTTATCCCTCATTTGGGTTGTATTAGACTAAAGTGATGCTTTGTATTTGTAGATTGAGTAGATGTACTAAATTAATTACCGATGAAGATGGACCAATTCCAAGATGCAAACCTTTCAAGTACACATATGGAAAGAAGATAGTAATATATTTTATATTTTGGTCTCATAGCTCTAGAGCAAGTCTTGCATCATGTAGCTTATTTTGA ATGGAATTTTTTCTCCTGAAGGCCCTTGATAGAGTTGTTGCATTGTTGAAAGTAGTCAGGCTAGCCACGGGGCACAATGCAATTGATATGGTTGGAACAATTCTATTAAATATATTACGAGGTGATATTGCAAGATTGAGTAGATGTACTAAATTAATTACCGATGAAGATGGACCAATTCCAAGATGCAAACCTTTCAAGTACACATATGGAAAGAAGATAGTAATATATTTTATATTTTGGTCTCATAGCTCTAGAGCAAGTCTTGCATCATGTAGCTTATTTTGA ATGGAATTTTTTCTCCTGAAGGCCCTTGATAGAGTTGTTGCATTGTTGAAAGTAGTCAGGCTAGCCACGGGGCACAATGCAATTGATATGGTTGGAACAATTCTATTAAATATATTACGAGGTGATATTGCAAGATTGAGTAGATGTACTAAATTAATTACCGATGAAGATGGACCAATTCCAAGATGCAAACCTTTCAAGTACACATATGGAAAGAAGATAGTAATATATTTTATATTTTGGTCTCATAGCTCTAGAGCAAGTCTTGCATCATGTAGCTTATTTTGA MEFFLLKALDRVVALLKVVRLATGHNAIDMVGTILLNILRGDIARLSRCTKLITDEDGPIPRCKPFKYTYGKKIVIYFIFWSHSSRASLASCSLF
BLAST of MELO3C012882.2 vs. NCBI nr
Match: XP_008447661.1 (PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Cucumis melo]) HSP 1 Score: 120.9 bits (302), Expect = 2.3e-24 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of MELO3C012882.2 vs. NCBI nr
Match: KVH95408.1 (Rossmann-like alpha/beta/alpha sandwich fold, partial [Cynara cardunculus var. scolymus]) HSP 1 Score: 116.7 bits (291), Expect = 4.3e-23 Identity = 60/79 (75.95%), Postives = 66/79 (83.54%), Query Frame = 0
BLAST of MELO3C012882.2 vs. NCBI nr
Match: XP_011649473.1 (PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Cucumis sativus] >KGN62283.1 hypothetical protein Csa_2G348210 [Cucumis sativus]) HSP 1 Score: 115.5 bits (288), Expect = 9.6e-23 Identity = 58/77 (75.32%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of MELO3C012882.2 vs. NCBI nr
Match: XP_022144278.1 (cytoplasmic tRNA 2-thiolation protein 1 [Momordica charantia]) HSP 1 Score: 115.5 bits (288), Expect = 9.6e-23 Identity = 58/77 (75.32%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of MELO3C012882.2 vs. NCBI nr
Match: XP_022951723.1 (cytoplasmic tRNA 2-thiolation protein 1 [Cucurbita moschata]) HSP 1 Score: 115.5 bits (288), Expect = 9.6e-23 Identity = 58/77 (75.32%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of MELO3C012882.2 vs. TAIR10
Match: AT1G76170.1 (2-thiocytidine tRNA biosynthesis protein, TtcA) HSP 1 Score: 109.8 bits (273), Expect = 9.5e-25 Identity = 54/77 (70.13%), Postives = 62/77 (80.52%), Query Frame = 0
BLAST of MELO3C012882.2 vs. TAIR10
Match: AT2G44270.2 (repressor of lrx1) HSP 1 Score: 99.0 bits (245), Expect = 1.7e-21 Identity = 48/67 (71.64%), Postives = 54/67 (80.60%), Query Frame = 0
BLAST of MELO3C012882.2 vs. Swiss-Prot
Match: sp|O64862|CTU1_ARATH (Cytoplasmic tRNA 2-thiolation protein 1 OS=Arabidopsis thaliana OX=3702 GN=NCS6 PE=2 SV=2) HSP 1 Score: 111.3 bits (277), Expect = 5.9e-24 Identity = 55/77 (71.43%), Postives = 62/77 (80.52%), Query Frame = 0
BLAST of MELO3C012882.2 vs. Swiss-Prot
Match: sp|Q6Z6G6|CTU1_ORYSJ (Cytoplasmic tRNA 2-thiolation protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=NCS6 PE=2 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.9e-23 Identity = 54/77 (70.13%), Postives = 62/77 (80.52%), Query Frame = 0
BLAST of MELO3C012882.2 vs. Swiss-Prot
Match: sp|Q05AW7|CTU1_XENLA (Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus laevis OX=8355 GN=ctu1 PE=2 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 6.3e-18 Identity = 43/77 (55.84%), Postives = 55/77 (71.43%), Query Frame = 0
BLAST of MELO3C012882.2 vs. Swiss-Prot
Match: sp|Q94480|CTU1_DICDI (Cytoplasmic tRNA 2-thiolation protein 1 OS=Dictyostelium discoideum OX=44689 GN=ctu1 PE=2 SV=2) HSP 1 Score: 90.1 bits (222), Expect = 1.4e-17 Identity = 42/77 (54.55%), Postives = 55/77 (71.43%), Query Frame = 0
BLAST of MELO3C012882.2 vs. Swiss-Prot
Match: sp|Q5FW05|CTU1_XENTR (Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus tropicalis OX=8364 GN=ctu1 PE=2 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.4e-17 Identity = 43/77 (55.84%), Postives = 54/77 (70.13%), Query Frame = 0
BLAST of MELO3C012882.2 vs. TrEMBL
Match: tr|A0A1S3BIV7|A0A1S3BIV7_CUCME (cytoplasmic tRNA 2-thiolation protein 1-like OS=Cucumis melo OX=3656 GN=LOC103490070 PE=3 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 1.5e-24 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of MELO3C012882.2 vs. TrEMBL
Match: tr|A0A103XR73|A0A103XR73_CYNCS (Rossmann-like alpha/beta/alpha sandwich fold (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_002507 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 2.8e-23 Identity = 60/79 (75.95%), Postives = 66/79 (83.54%), Query Frame = 0
BLAST of MELO3C012882.2 vs. TrEMBL
Match: tr|A0A0A0LKF0|A0A0A0LKF0_CUCSA (Cytoplasmic tRNA 2-thiolation protein 1 OS=Cucumis sativus OX=3659 GN=NCS6 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 6.3e-23 Identity = 58/77 (75.32%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of MELO3C012882.2 vs. TrEMBL
Match: tr|A0A251RKY3|A0A251RKY3_HELAN (Putative 2-thiocytidine tRNA biosynthesis protein, TtcA OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0533361 PE=4 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 1.1e-22 Identity = 57/74 (77.03%), Postives = 63/74 (85.14%), Query Frame = 0
BLAST of MELO3C012882.2 vs. TrEMBL
Match: tr|A0A0D3D124|A0A0D3D124_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea OX=109376 PE=4 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 1.1e-22 Identity = 56/74 (75.68%), Postives = 62/74 (83.78%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |