MELO3C012882 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATTTTTTCTCCTGAAGGCCCTTGATAGAGTTGTTGCATTGTTGAAAGTAGTCAGGCTAGCCACGGGGCACAATGCAATTGATATGGTTGGAACAATTCTATTAAATATATTACGAGGTGATATTGCAAGGTATTTTAATAGTAAGACTTTTTTTTTCAATTACTTTATCCCTCATTTGGGTTGTATTAGACTAAAGTGATGCTTTGTATTTGTAGATTGAGTAGATGTACTAAATTAATTACCGATGAAGATGGACCAATTCCAAGATGCAAACCTTTCAAGTACACATATGGAAAGAAGATAGTAATATATTTTATATTTTGGTCTCATAGCTCTAGAGCAAGTCTTGCATCATGTAGCTTATTTTGA ATGGAATTTTTTCTCCTGAAGGCCCTTGATAGAGTTGTTGCATTGTTGAAAGTAGTCAGGCTAGCCACGGGGCACAATGCAATTGATATGGTTGGAACAATTCTATTAAATATATTACGAGGTGATATTGCAAGATTGAGTAGATGTACTAAATTAATTACCGATGAAGATGGACCAATTCCAAGATGCAAACCTTTCAAGTACACATATGGAAAGAAGATAGTAATATATTTTATATTTTGGTCTCATAGCTCTAGAGCAAGTCTTGCATCATGTAGCTTATTTTGA ATGGAATTTTTTCTCCTGAAGGCCCTTGATAGAGTTGTTGCATTGTTGAAAGTAGTCAGGCTAGCCACGGGGCACAATGCAATTGATATGGTTGGAACAATTCTATTAAATATATTACGAGGTGATATTGCAAGATTGAGTAGATGTACTAAATTAATTACCGATGAAGATGGACCAATTCCAAGATGCAAACCTTTCAAGTACACATATGGAAAGAAGATAGTAATATATTTTATATTTTGGTCTCATAGCTCTAGAGCAAGTCTTGCATCATGTAGCTTATTTTGA MEFFLLKALDRVVALLKVVRLATGHNAIDMVGTILLNILRGDIARLSRCTKLITDEDGPIPRCKPFKYTYGKKIVIYFIFWSHSSRASLASCSLF*
BLAST of MELO3C012882 vs. Swiss-Prot
Match: CTU1_ARATH (Cytoplasmic tRNA 2-thiolation protein 1 OS=Arabidopsis thaliana GN=NCS6 PE=2 SV=2) HSP 1 Score: 112.8 bits (281), Expect = 2.0e-24 Identity = 55/77 (71.43%), Postives = 60/77 (77.92%), Query Frame = 1
BLAST of MELO3C012882 vs. Swiss-Prot
Match: CTU1_ORYSJ (Cytoplasmic tRNA 2-thiolation protein 1 OS=Oryza sativa subsp. japonica GN=NCS6 PE=2 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.0e-23 Identity = 54/77 (70.13%), Postives = 60/77 (77.92%), Query Frame = 1
BLAST of MELO3C012882 vs. Swiss-Prot
Match: CTU1_XENLA (Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus laevis GN=ctu1 PE=2 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 2.2e-18 Identity = 43/77 (55.84%), Postives = 53/77 (68.83%), Query Frame = 1
BLAST of MELO3C012882 vs. Swiss-Prot
Match: CTU1_XENTR (Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus tropicalis GN=ctu1 PE=2 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 4.8e-18 Identity = 43/77 (55.84%), Postives = 52/77 (67.53%), Query Frame = 1
BLAST of MELO3C012882 vs. Swiss-Prot
Match: CTU1_DICDI (Cytoplasmic tRNA 2-thiolation protein 1 OS=Dictyostelium discoideum GN=ctu1 PE=2 SV=2) HSP 1 Score: 91.7 bits (226), Expect = 4.8e-18 Identity = 42/77 (54.55%), Postives = 53/77 (68.83%), Query Frame = 1
BLAST of MELO3C012882 vs. TrEMBL
Match: A0A103XR73_CYNCS (Rossmann-like alpha/beta/alpha sandwich fold (Fragment) OS=Cynara cardunculus var. scolymus GN=Ccrd_002507 PE=4 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 4.1e-24 Identity = 60/79 (75.95%), Postives = 66/79 (83.54%), Query Frame = 1
BLAST of MELO3C012882 vs. TrEMBL
Match: A0A0A0LKF0_CUCSA (Cytoplasmic tRNA 2-thiolation protein 1 OS=Cucumis sativus GN=NCS6 PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.2e-23 Identity = 58/77 (75.32%), Postives = 64/77 (83.12%), Query Frame = 1
BLAST of MELO3C012882 vs. TrEMBL
Match: A0A0D3D124_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=4 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 2.7e-23 Identity = 56/74 (75.68%), Postives = 62/74 (83.78%), Query Frame = 1
BLAST of MELO3C012882 vs. TrEMBL
Match: E0CQT4_VITVI (Cytoplasmic tRNA 2-thiolation protein 1 OS=Vitis vinifera GN=NCS6 PE=3 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 4.5e-23 Identity = 56/74 (75.68%), Postives = 63/74 (85.14%), Query Frame = 1
BLAST of MELO3C012882 vs. TrEMBL
Match: A0A0D2TSG6_GOSRA (Cytoplasmic tRNA 2-thiolation protein 1 OS=Gossypium raimondii GN=NCS6 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 5.9e-23 Identity = 56/77 (72.73%), Postives = 64/77 (83.12%), Query Frame = 1
BLAST of MELO3C012882 vs. TAIR10
Match: AT1G76170.1 (AT1G76170.1 2-thiocytidine tRNA biosynthesis protein, TtcA) HSP 1 Score: 111.3 bits (277), Expect = 3.3e-25 Identity = 54/77 (70.13%), Postives = 60/77 (77.92%), Query Frame = 1
BLAST of MELO3C012882 vs. TAIR10
Match: AT2G44270.2 (AT2G44270.2 repressor of lrx1) HSP 1 Score: 100.5 bits (249), Expect = 5.9e-22 Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
BLAST of MELO3C012882 vs. NCBI nr
Match: gi|659093684|ref|XP_008447661.1| (PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Cucumis melo]) HSP 1 Score: 121.3 bits (303), Expect = 9.1e-25 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of MELO3C012882 vs. NCBI nr
Match: gi|976908178|gb|KVH95408.1| (Rossmann-like alpha/beta/alpha sandwich fold, partial [Cynara cardunculus var. scolymus]) HSP 1 Score: 118.6 bits (296), Expect = 5.9e-24 Identity = 60/79 (75.95%), Postives = 66/79 (83.54%), Query Frame = 1
BLAST of MELO3C012882 vs. NCBI nr
Match: gi|778670437|ref|XP_011649473.1| (PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Cucumis sativus]) HSP 1 Score: 117.1 bits (292), Expect = 1.7e-23 Identity = 58/77 (75.32%), Postives = 64/77 (83.12%), Query Frame = 1
BLAST of MELO3C012882 vs. NCBI nr
Match: gi|764540666|ref|XP_004291313.2| (PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Fragaria vesca subsp. vesca]) HSP 1 Score: 115.5 bits (288), Expect = 5.0e-23 Identity = 56/77 (72.73%), Postives = 64/77 (83.12%), Query Frame = 1
BLAST of MELO3C012882 vs. NCBI nr
Match: gi|657970684|ref|XP_008377106.1| (PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Malus domestica]) HSP 1 Score: 115.5 bits (288), Expect = 5.0e-23 Identity = 56/77 (72.73%), Postives = 64/77 (83.12%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |