MELO3C012661 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGTAAGTATTGTTTTGGGAATGGTGGGGTTGTTGTTATGGGCAGGGGAAGCAGTGGGTCAATCCTCGGATTGTAACAATGTGTTGATTAGCCTCTCACCTTGCCTTAATTATATCAACGGCAACTCCTCCACCCCGTCTCCAAGTTGCTGCTCGCAACTGACCACCGTCGTCCGCTCCCAACCCCAATGTCTTTGCCAAGTCTTCGATAACGGTGGCGGTGCCTCCGCGCTTGGAGGGCTAAATGTCAATCAAACTCTGGCTCTTGCGCTCCCTGCTGCTTGTCGTCTACAAACTCCGCCCATTTCCCGCTGTAACGGTAAAACTTGA ATGGAAGTAAGTATTGTTTTGGGAATGGTGGGGTTGTTGTTATGGGCAGGGGAAGCAGTGGGTCAATCCTCGGATTGTAACAATGTGTTGATTAGCCTCTCACCTTGCCTTAATTATATCAACGGCAACTCCTCCACCCCGTCTCCAAGTTGCTGCTCGCAACTGACCACCGTCGTCCGCTCCCAACCCCAATGTCTTTGCCAAGTCTTCGATAACGGTGGCGGTGCCTCCGCGCTTGGAGGGCTAAATGTCAATCAAACTCTGGCTCTTGCGCTCCCTGCTGCTTGTCGTCTACAAACTCCGCCCATTTCCCGCTGTAACGGTAAAACTTGA ATGGAAGTAAGTATTGTTTTGGGAATGGTGGGGTTGTTGTTATGGGCAGGGGAAGCAGTGGGTCAATCCTCGGATTGTAACAATGTGTTGATTAGCCTCTCACCTTGCCTTAATTATATCAACGGCAACTCCTCCACCCCGTCTCCAAGTTGCTGCTCGCAACTGACCACCGTCGTCCGCTCCCAACCCCAATGTCTTTGCCAAGTCTTCGATAACGGTGGCGGTGCCTCCGCGCTTGGAGGGCTAAATGTCAATCAAACTCTGGCTCTTGCGCTCCCTGCTGCTTGTCGTCTACAAACTCCGCCCATTTCCCGCTGTAACGGTAAAACTTGA MEVSIVLGMVGLLLWAGEAVGQSSDCNNVLISLSPCLNYINGNSSTPSPSCCSQLTTVVRSQPQCLCQVFDNGGGASALGGLNVNQTLALALPAACRLQTPPISRCNGKT*
BLAST of MELO3C012661 vs. Swiss-Prot
Match: NLTL2_ARATH (Non-specific lipid-transfer protein-like protein At2g13820 OS=Arabidopsis thaliana GN=At2g13820 PE=1 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 8.3e-14 Identity = 34/95 (35.79%), Postives = 58/95 (61.05%), Query Frame = 1
BLAST of MELO3C012661 vs. Swiss-Prot
Match: NLTL5_ARATH (Non-specific lipid-transfer protein-like protein At5g64080 OS=Arabidopsis thaliana GN=At5g64080 PE=1 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.3e-11 Identity = 34/90 (37.78%), Postives = 54/90 (60.00%), Query Frame = 1
BLAST of MELO3C012661 vs. Swiss-Prot
Match: YLS3_ARATH (Protein YLS3 OS=Arabidopsis thaliana GN=YLS3 PE=2 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 3.0e-11 Identity = 39/108 (36.11%), Postives = 57/108 (52.78%), Query Frame = 1
BLAST of MELO3C012661 vs. Swiss-Prot
Match: VAS_ARATH (Lipid transfer-like protein VAS OS=Arabidopsis thaliana GN=VAS PE=2 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.1e-09 Identity = 35/85 (41.18%), Postives = 46/85 (54.12%), Query Frame = 1
BLAST of MELO3C012661 vs. Swiss-Prot
Match: LTPG2_ARATH (Non-specific lipid transfer protein GPI-anchored 2 OS=Arabidopsis thaliana GN=LTPG2 PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 2.3e-08 Identity = 30/87 (34.48%), Postives = 46/87 (52.87%), Query Frame = 1
BLAST of MELO3C012661 vs. TrEMBL
Match: A0A059B3V7_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_H03442 PE=3 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 1.2e-30 Identity = 73/107 (68.22%), Postives = 83/107 (77.57%), Query Frame = 1
BLAST of MELO3C012661 vs. TrEMBL
Match: A0A067FZT6_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g031445mg PE=3 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 2.6e-30 Identity = 61/107 (57.01%), Postives = 81/107 (75.70%), Query Frame = 1
BLAST of MELO3C012661 vs. TrEMBL
Match: V4TUV5_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10021499mg PE=3 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 2.6e-30 Identity = 61/107 (57.01%), Postives = 81/107 (75.70%), Query Frame = 1
BLAST of MELO3C012661 vs. TrEMBL
Match: V4TUV5_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10021499mg PE=3 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 4.7e-24 Identity = 60/107 (56.07%), Postives = 78/107 (72.90%), Query Frame = 1
HSP 2 Score: 139.0 bits (349), Expect = 3.4e-30 Identity = 69/107 (64.49%), Postives = 86/107 (80.37%), Query Frame = 1
BLAST of MELO3C012661 vs. TrEMBL
Match: B9SFJ1_RICCO (Lipid binding protein, putative OS=Ricinus communis GN=RCOM_0646570 PE=3 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 7.6e-30 Identity = 69/108 (63.89%), Postives = 80/108 (74.07%), Query Frame = 1
BLAST of MELO3C012661 vs. TAIR10
Match: AT3G22600.1 (AT3G22600.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 123.2 bits (308), Expect = 9.8e-29 Identity = 59/107 (55.14%), Postives = 73/107 (68.22%), Query Frame = 1
BLAST of MELO3C012661 vs. TAIR10
Match: AT4G14815.1 (AT4G14815.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 105.1 bits (261), Expect = 2.7e-23 Identity = 49/88 (55.68%), Postives = 59/88 (67.05%), Query Frame = 1
BLAST of MELO3C012661 vs. TAIR10
Match: AT2G48130.1 (AT2G48130.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 102.1 bits (253), Expect = 2.3e-22 Identity = 47/97 (48.45%), Postives = 63/97 (64.95%), Query Frame = 1
BLAST of MELO3C012661 vs. TAIR10
Match: AT1G03103.1 (AT1G03103.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 97.1 bits (240), Expect = 7.5e-21 Identity = 50/107 (46.73%), Postives = 66/107 (61.68%), Query Frame = 1
BLAST of MELO3C012661 vs. TAIR10
Match: AT2G13820.1 (AT2G13820.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 77.8 bits (190), Expect = 4.7e-15 Identity = 34/95 (35.79%), Postives = 58/95 (61.05%), Query Frame = 1
BLAST of MELO3C012661 vs. NCBI nr
Match: gi|659092642|ref|XP_008447158.1| (PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Cucumis melo]) HSP 1 Score: 221.1 bits (562), Expect = 9.7e-55 Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 1
BLAST of MELO3C012661 vs. NCBI nr
Match: gi|747086396|ref|XP_011090697.1| (PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Sesamum indicum]) HSP 1 Score: 142.5 bits (358), Expect = 4.4e-31 Identity = 71/107 (66.36%), Postives = 88/107 (82.24%), Query Frame = 1
BLAST of MELO3C012661 vs. NCBI nr
Match: gi|702444276|ref|XP_010024255.1| (PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Eucalyptus grandis]) HSP 1 Score: 140.6 bits (353), Expect = 1.7e-30 Identity = 73/107 (68.22%), Postives = 83/107 (77.57%), Query Frame = 1
BLAST of MELO3C012661 vs. NCBI nr
Match: gi|568852049|ref|XP_006479693.1| (PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Citrus sinensis]) HSP 1 Score: 139.4 bits (350), Expect = 3.7e-30 Identity = 61/107 (57.01%), Postives = 81/107 (75.70%), Query Frame = 1
BLAST of MELO3C012661 vs. NCBI nr
Match: gi|641849807|gb|KDO68681.1| (hypothetical protein CISIN_1g031445mg [Citrus sinensis]) HSP 1 Score: 139.4 bits (350), Expect = 3.7e-30 Identity = 61/107 (57.01%), Postives = 81/107 (75.70%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|