MELO3C012585 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGGAATTTGAGCAACAGGTGAATTTCATTTGTTTGAGTGCAGGATGATGATTCCGTTTGTATTTGTTTGCTTATCTTTGTCTTTTTATGCAATAGAGAGTAGAAATGAATGGCGTGTTAGCTCGAAATGTAGAGTTCTCACAACTTATTGTAGACTACCAAAGAAAACTGCGGGAAGTTTCAGAATCCCTGCACAGTGCTGATGAACAGTCCCGGAAATTGAGTATTGAGGTAAAACTTTATGCGTAATCATTAAGTGGGGTTTGTTACCATTCTCATCTCCTACTTCTGTATTTTAAAGGTGTCTGTCTTAAAGTCTGAAAAGGACTTGTTATCAAATGCTGAAAAGAGAGCACAGGATGAAATTCAAAAGCTGTCTGAAAGATTATTCCGGGTGCAGGTTAGCTTCTAA ATGAAGGAATTTGAGCAACAGAGAGTAGAAATGAATGGCGTGTTAGCTCGAAATGTAGAGTTCTCACAACTTATTGTAGACTACCAAAGAAAACTGCGGGAAGTTTCAGAATCCCTGCACAGTGCTGATGAACAGTCCCGGAAATTGAGTATTGAGGTGTCTGTCTTAAAGTCTGAAAAGGACTTGTTATCAAATGCTGAAAAGAGAGCACAGGATGAAATTCAAAAGCTGTCTGAAAGATTATTCCGGGTGCAGGTTAGCTTCTAA ATGAAGGAATTTGAGCAACAGAGAGTAGAAATGAATGGCGTGTTAGCTCGAAATGTAGAGTTCTCACAACTTATTGTAGACTACCAAAGAAAACTGCGGGAAGTTTCAGAATCCCTGCACAGTGCTGATGAACAGTCCCGGAAATTGAGTATTGAGGTGTCTGTCTTAAAGTCTGAAAAGGACTTGTTATCAAATGCTGAAAAGAGAGCACAGGATGAAATTCAAAAGCTGTCTGAAAGATTATTCCGGGTGCAGGTTAGCTTCTAA MKEFEQQRVEMNGVLARNVEFSQLIVDYQRKLREVSESLHSADEQSRKLSIEVSVLKSEKDLLSNAEKRAQDEIQKLSERLFRVQVSF*
BLAST of MELO3C012585 vs. Swiss-Prot
Match: NUA_ARATH (Nuclear-pore anchor OS=Arabidopsis thaliana GN=NUA PE=1 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 6.2e-28 Identity = 62/87 (71.26%), Postives = 75/87 (86.21%), Query Frame = 1
BLAST of MELO3C012585 vs. TrEMBL
Match: A0A0A0K7K3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G252150 PE=4 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 2.3e-37 Identity = 86/87 (98.85%), Postives = 86/87 (98.85%), Query Frame = 1
BLAST of MELO3C012585 vs. TrEMBL
Match: W9QYR8_9ROSA (Nuclear-pore anchor OS=Morus notabilis GN=L484_019211 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 2.8e-27 Identity = 65/87 (74.71%), Postives = 78/87 (89.66%), Query Frame = 1
BLAST of MELO3C012585 vs. TrEMBL
Match: A0A0D3D1T0_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 6.9e-26 Identity = 61/87 (70.11%), Postives = 78/87 (89.66%), Query Frame = 1
BLAST of MELO3C012585 vs. TrEMBL
Match: M4F208_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 6.9e-26 Identity = 61/87 (70.11%), Postives = 78/87 (89.66%), Query Frame = 1
BLAST of MELO3C012585 vs. TrEMBL
Match: A0A078DG60_BRANA (BnaA07g34790D protein OS=Brassica napus GN=BnaA07g34790D PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 6.9e-26 Identity = 61/87 (70.11%), Postives = 78/87 (89.66%), Query Frame = 1
BLAST of MELO3C012585 vs. TAIR10
Match: AT1G79280.2 (AT1G79280.2 nuclear pore anchor) HSP 1 Score: 124.4 bits (311), Expect = 3.5e-29 Identity = 62/87 (71.26%), Postives = 75/87 (86.21%), Query Frame = 1
BLAST of MELO3C012585 vs. NCBI nr
Match: gi|778726110|ref|XP_011659058.1| (PREDICTED: nuclear-pore anchor isoform X3 [Cucumis sativus]) HSP 1 Score: 162.5 bits (410), Expect = 3.3e-37 Identity = 86/87 (98.85%), Postives = 86/87 (98.85%), Query Frame = 1
BLAST of MELO3C012585 vs. NCBI nr
Match: gi|700189074|gb|KGN44307.1| (hypothetical protein Csa_7G252150 [Cucumis sativus]) HSP 1 Score: 162.5 bits (410), Expect = 3.3e-37 Identity = 86/87 (98.85%), Postives = 86/87 (98.85%), Query Frame = 1
BLAST of MELO3C012585 vs. NCBI nr
Match: gi|659092949|ref|XP_008447306.1| (PREDICTED: nuclear-pore anchor-like [Cucumis melo]) HSP 1 Score: 162.5 bits (410), Expect = 3.3e-37 Identity = 86/87 (98.85%), Postives = 86/87 (98.85%), Query Frame = 1
BLAST of MELO3C012585 vs. NCBI nr
Match: gi|778726106|ref|XP_011659057.1| (PREDICTED: nuclear-pore anchor isoform X2 [Cucumis sativus]) HSP 1 Score: 162.5 bits (410), Expect = 3.3e-37 Identity = 86/87 (98.85%), Postives = 86/87 (98.85%), Query Frame = 1
BLAST of MELO3C012585 vs. NCBI nr
Match: gi|778726103|ref|XP_011659056.1| (PREDICTED: nuclear-pore anchor isoform X1 [Cucumis sativus]) HSP 1 Score: 162.5 bits (410), Expect = 3.3e-37 Identity = 86/87 (98.85%), Postives = 86/87 (98.85%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|