MELO3C012384.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.GGACAATGCTATGGAATCAGCCTTGCTAGAGAAGAAAATCAATATATTGCTTATGTAGCTTATCCTCTAGACCTTTTTGAAGAAGGTTCTGTTACTAACATGTTTACTTCCATTGTGGGTAATGCATTTGGATTCAAGGTTCTACGTGCTTTACGACTAGAAGATTTGCGAATCCCTACCGCTTATATTAAAACTTTCTAA GGACAATGCTATGGAATCAGCCTTGCTAGAGAAGAAAATCAATATATTGCTTATGTAGCTTATCCTCTAGACCTTTTTGAAGAAGGTTCTGTTACTAACATGTTTACTTCCATTGTGGGTAATGCATTTGGATTCAAGGTTCTACGTGCTTTACGACTAGAAGATTTGCGAATCCCTACCGCTTATATTAAAACTTTCTAA GGACAATGCTATGGAATCAGCCTTGCTAGAGAAGAAAATCAATATATTGCTTATGTAGCTTATCCTCTAGACCTTTTTGAAGAAGGTTCTGTTACTAACATGTTTACTTCCATTGTGGGTAATGCATTTGGATTCAAGGTTCTACGTGCTTTACGACTAGAAGATTTGCGAATCCCTACCGCTTATATTAAAACTTTCTAA GQCYGISLAREENQYIAYVAYPLDLFEEGSVTNMFTSIVGNAFGFKVLRALRLEDLRIPTAYIKTF
BLAST of MELO3C012384.2 vs. NCBI nr
Match: AAA84358.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Luffa quinquefida]) HSP 1 Score: 121.7 bits (304), Expect = 9.3e-25 Identity = 60/67 (89.55%), Postives = 62/67 (92.54%), Query Frame = 0
BLAST of MELO3C012384.2 vs. NCBI nr
Match: CAD12550.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (plastid) [Ricinocarpos tuberculatus]) HSP 1 Score: 121.7 bits (304), Expect = 9.3e-25 Identity = 60/67 (89.55%), Postives = 62/67 (92.54%), Query Frame = 0
BLAST of MELO3C012384.2 vs. NCBI nr
Match: AAP88013.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (chloroplast) [Coccinia adoensis]) HSP 1 Score: 121.7 bits (304), Expect = 9.3e-25 Identity = 60/67 (89.55%), Postives = 62/67 (92.54%), Query Frame = 0
BLAST of MELO3C012384.2 vs. NCBI nr
Match: BAF40676.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Fontainea venosa]) HSP 1 Score: 121.7 bits (304), Expect = 9.3e-25 Identity = 60/67 (89.55%), Postives = 62/67 (92.54%), Query Frame = 0
BLAST of MELO3C012384.2 vs. NCBI nr
Match: BAF40661.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Dalechampia spathulata]) HSP 1 Score: 121.7 bits (304), Expect = 9.3e-25 Identity = 60/67 (89.55%), Postives = 62/67 (92.54%), Query Frame = 0
BLAST of MELO3C012384.2 vs. TAIR10
Match: ATCG00490.1 (ribulose-bisphosphate carboxylases) HSP 1 Score: 106.3 bits (264), Expect = 7.3e-24 Identity = 53/67 (79.10%), Postives = 56/67 (83.58%), Query Frame = 0
BLAST of MELO3C012384.2 vs. Swiss-Prot
Match: sp|P27064|RBL_CUCSA (Ribulose bisphosphate carboxylase large chain OS=Cucumis sativus OX=3659 GN=rbcL PE=1 SV=5) HSP 1 Score: 121.7 bits (304), Expect = 3.0e-27 Identity = 60/67 (89.55%), Postives = 62/67 (92.54%), Query Frame = 0
BLAST of MELO3C012384.2 vs. Swiss-Prot
Match: sp|P27066|RBL_SOYBN (Ribulose bisphosphate carboxylase large chain OS=Glycine max OX=3847 GN=rbcL PE=1 SV=3) HSP 1 Score: 120.9 bits (302), Expect = 5.2e-27 Identity = 59/67 (88.06%), Postives = 62/67 (92.54%), Query Frame = 0
BLAST of MELO3C012384.2 vs. Swiss-Prot
Match: sp|O62943|RBL_SESSE (Ribulose bisphosphate carboxylase large chain OS=Sesbania sesban OX=76396 GN=rbcL PE=3 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 6.8e-27 Identity = 59/67 (88.06%), Postives = 62/67 (92.54%), Query Frame = 0
BLAST of MELO3C012384.2 vs. Swiss-Prot
Match: sp|P36478|RBL_ANTGA (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Anthocleista grandiflora OX=28539 GN=rbcL PE=3 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 1.2e-26 Identity = 59/67 (88.06%), Postives = 61/67 (91.04%), Query Frame = 0
BLAST of MELO3C012384.2 vs. Swiss-Prot
Match: sp|P48697|RBL_CUCPE (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Cucurbita pepo OX=3663 GN=rbcL PE=3 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 1.2e-26 Identity = 59/67 (88.06%), Postives = 61/67 (91.04%), Query Frame = 0
BLAST of MELO3C012384.2 vs. TrEMBL
Match: tr|G0YUA0|G0YUA0_9ROSI (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Trichosanthes cucumeroides OX=685054 GN=rbcL PE=3 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 6.2e-25 Identity = 60/67 (89.55%), Postives = 62/67 (92.54%), Query Frame = 0
BLAST of MELO3C012384.2 vs. TrEMBL
Match: tr|A0A0U4EXV3|A0A0U4EXV3_9ROSI (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Trichosanthes cucumerina OX=50543 GN=rbcL PE=3 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 6.2e-25 Identity = 60/67 (89.55%), Postives = 62/67 (92.54%), Query Frame = 0
BLAST of MELO3C012384.2 vs. TrEMBL
Match: tr|A0A2D1LWI2|A0A2D1LWI2_9ROSI (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Macaranga sp. JH-2017 OX=2048407 GN=rbcL PE=3 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 6.2e-25 Identity = 60/67 (89.55%), Postives = 62/67 (92.54%), Query Frame = 0
BLAST of MELO3C012384.2 vs. TrEMBL
Match: tr|A0A286NG18|A0A286NG18_CUCME (Ribulose bisphosphate carboxylase large chain OS=Cucumis melo var. flexuosus OX=1120798 GN=rbcL PE=3 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 6.2e-25 Identity = 60/67 (89.55%), Postives = 62/67 (92.54%), Query Frame = 0
BLAST of MELO3C012384.2 vs. TrEMBL
Match: tr|A0A249RY12|A0A249RY12_CUCME (Ribulose bisphosphate carboxylase large chain OS=Cucumis melo subsp. agrestis OX=217619 GN=rbcL PE=3 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 6.2e-25 Identity = 60/67 (89.55%), Postives = 62/67 (92.54%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |