MELO3C010867 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.GATAGTCGGCCGTTGTAGTAGAGCAACTCTCATCGAACTCCGGAAGCGGAAGCAGGGCCAAGGGAGACAACCATGGGTCGTATGCACAGTAGTGGTAAGGGTATTTCCGCCTCTGCATTGCCCTACAAGAGGATGCCACCAAGTTGGCTCAAGATCTCTTCTACGGATGTTGAAGATAATATCTGCAAATTTGCGAAGAAGGGCTTAACCCCTTCTCAAATTGGTTTGTGATTCTCACGGGATTGCCCAGGTCAAAAGTGTTACCGGAAACAAAATATTGCGTATTCAAGGTCCATGGACTTGCACCTGAGATTCCAGAGGATCTCTATCACTTAATCAAGAAAGCAGTTTCCATCCGTAAGCATTTGGAGAGGAACAGGAAGGACAAAGACTCCAAGTTCAGATTGATTCTCGTGGAGAGCAGAATTCACAGACTTGCTCGTTACTATAAGAACTCTCCTACCCTAAACCATAAAATAATTAATTGA GATAGTCGGCCGTTGTAGTAGAGCAACTCTCATCGAACTCCGGAAGCGGAAGCAGGGCCAAGGGAGACAACCATGGGTCGTATGCACAGTAGTGGTAAGGGTATTTCCGCCTCTGCATTGCCCTACAAGAGGATGCCACCAAGTTGGCTCAAGATCTCTTCTACGGATGTTGAAGATAATATCTGCAAATTTGCGAAGAAGGGCTTAACCCCTTCTCAAATTGAGGATCTCTATCACTTAATCAAGAAAGCAGTTTCCATCCGTAAGCATTTGGAGAGGAACAGGAAGGACAAAGACTCCAAGTTCAGATTGATTCTCGTGGAGAGCAGAATTCACAGACTTGCTCGTTACTATAAGAACTCTCCTACCCTAAACCATAAAATAATTAATTGA ATGGGTCGTATGCACAGTAGTGGTAAGGGTATTTCCGCCTCTGCATTGCCCTACAAGAGGATGCCACCAAGTTGGCTCAAGATCTCTTCTACGGATGTTGAAGATAATATCTGCAAATTTGCGAAGAAGGGCTTAACCCCTTCTCAAATTGAGGATCTCTATCACTTAATCAAGAAAGCAGTTTCCATCCGTAAGCATTTGGAGAGGAACAGGAAGGACAAAGACTCCAAGTTCAGATTGATTCTCGTGGAGAGCAGAATTCACAGACTTGCTCGTTACTATAAGAACTCTCCTACCCTAAACCATAAAATAATTAATTGA MGRMHSSGKGISASALPYKRMPPSWLKISSTDVEDNICKFAKKGLTPSQIEDLYHLIKKAVSIRKHLERNRKDKDSKFRLILVESRIHRLARYYKNSPTLNHKIIN*
BLAST of MELO3C010867 vs. Swiss-Prot
Match: RS13_BOVIN (40S ribosomal protein S13 OS=Bos taurus GN=RPS13 PE=2 SV=3) HSP 1 Score: 143.3 bits (360), Expect = 1.6e-33 Identity = 76/135 (56.30%), Postives = 86/135 (63.70%), Query Frame = 1
BLAST of MELO3C010867 vs. Swiss-Prot
Match: RS13_RAT (40S ribosomal protein S13 OS=Rattus norvegicus GN=Rps13 PE=1 SV=2) HSP 1 Score: 143.3 bits (360), Expect = 1.6e-33 Identity = 76/135 (56.30%), Postives = 86/135 (63.70%), Query Frame = 1
BLAST of MELO3C010867 vs. Swiss-Prot
Match: RS13_MOUSE (40S ribosomal protein S13 OS=Mus musculus GN=Rps13 PE=1 SV=2) HSP 1 Score: 143.3 bits (360), Expect = 1.6e-33 Identity = 76/135 (56.30%), Postives = 86/135 (63.70%), Query Frame = 1
BLAST of MELO3C010867 vs. Swiss-Prot
Match: RS13_CHICK (40S ribosomal protein S13 OS=Gallus gallus GN=RPS13 PE=2 SV=3) HSP 1 Score: 143.3 bits (360), Expect = 1.6e-33 Identity = 76/135 (56.30%), Postives = 86/135 (63.70%), Query Frame = 1
BLAST of MELO3C010867 vs. Swiss-Prot
Match: RS13_CRIGR (40S ribosomal protein S13 OS=Cricetulus griseus GN=RPS13 PE=3 SV=3) HSP 1 Score: 143.3 bits (360), Expect = 1.6e-33 Identity = 76/135 (56.30%), Postives = 86/135 (63.70%), Query Frame = 1
BLAST of MELO3C010867 vs. TrEMBL
Match: W9RYU7_9ROSA (40S ribosomal protein S13 OS=Morus notabilis GN=L484_023230 PE=3 SV=1) HSP 1 Score: 175.3 bits (443), Expect = 4.1e-41 Identity = 91/115 (79.13%), Postives = 94/115 (81.74%), Query Frame = 1
BLAST of MELO3C010867 vs. TrEMBL
Match: A0A0D2RT37_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G040700 PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 5.6e-38 Identity = 90/131 (68.70%), Postives = 93/131 (70.99%), Query Frame = 1
BLAST of MELO3C010867 vs. TrEMBL
Match: A0A118K3A9_CYNCS (Ribosomal protein S13/S15, N-terminal OS=Cynara cardunculus var. scolymus GN=Ccrd_016023 PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.7e-37 Identity = 89/135 (65.93%), Postives = 92/135 (68.15%), Query Frame = 1
BLAST of MELO3C010867 vs. TrEMBL
Match: G7JLB5_MEDTR (Cytoplasmic ribosomal protein S13 OS=Medicago truncatula GN=MTR_4g102170 PE=2 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 6.8e-36 Identity = 86/135 (63.70%), Postives = 90/135 (66.67%), Query Frame = 1
BLAST of MELO3C010867 vs. TrEMBL
Match: B7FMC8_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 155.2 bits (391), Expect = 4.4e-35 Identity = 84/132 (63.64%), Postives = 88/132 (66.67%), Query Frame = 1
BLAST of MELO3C010867 vs. TAIR10
Match: AT4G00100.1 (AT4G00100.1 ribosomal protein S13A) HSP 1 Score: 130.6 bits (327), Expect = 5.9e-31 Identity = 77/135 (57.04%), Postives = 79/135 (58.52%), Query Frame = 1
BLAST of MELO3C010867 vs. TAIR10
Match: AT3G60770.1 (AT3G60770.1 Ribosomal protein S13/S15) HSP 1 Score: 128.6 bits (322), Expect = 2.2e-30 Identity = 76/135 (56.30%), Postives = 78/135 (57.78%), Query Frame = 1
BLAST of MELO3C010867 vs. NCBI nr
Match: gi|703143947|ref|XP_010108141.1| (40S ribosomal protein S13 [Morus notabilis]) HSP 1 Score: 175.3 bits (443), Expect = 5.9e-41 Identity = 91/115 (79.13%), Postives = 94/115 (81.74%), Query Frame = 1
BLAST of MELO3C010867 vs. NCBI nr
Match: gi|747059822|ref|XP_011076311.1| (PREDICTED: 40S ribosomal protein S13-like [Sesamum indicum]) HSP 1 Score: 168.7 bits (426), Expect = 5.5e-39 Identity = 89/127 (70.08%), Postives = 94/127 (74.02%), Query Frame = 1
BLAST of MELO3C010867 vs. NCBI nr
Match: gi|763754984|gb|KJB22315.1| (hypothetical protein B456_004G040700 [Gossypium raimondii]) HSP 1 Score: 164.9 bits (416), Expect = 8.0e-38 Identity = 90/131 (68.70%), Postives = 93/131 (70.99%), Query Frame = 1
BLAST of MELO3C010867 vs. NCBI nr
Match: gi|976920934|gb|KVI05640.1| (Ribosomal protein S13/S15, N-terminal [Cynara cardunculus var. scolymus]) HSP 1 Score: 161.8 bits (408), Expect = 6.8e-37 Identity = 89/135 (65.93%), Postives = 92/135 (68.15%), Query Frame = 1
BLAST of MELO3C010867 vs. NCBI nr
Match: gi|357477043|ref|XP_003608807.1| (cytoplasmic ribosomal protein S13 [Medicago truncatula]) HSP 1 Score: 157.9 bits (398), Expect = 9.8e-36 Identity = 86/135 (63.70%), Postives = 90/135 (66.67%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |