MELO3C010577 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTCCTTCTCATCCTTCTCCTCTTCGTCTTCACTATCTTTGCCTTCGCCGTCACCAACAAAGGCGTCGGAAAAGTTCTCTCGAACAGAGGATGTAAAGAGTACAGACTCAGTGATTACTCCAACTGGCTACAGAATCACGTCAGGAACAACAAAGATTGGAACAGAATCAAAAGCTGTTTAGTCGACGACAAGGTCTGTGCCGAATTCAACCAGAAATTCGCTTCTGAAACCATTGAGCAATTCTACCAAGAAGACTTATCTTCAATTCAAGTATGA ATGTTCCTTCTCATCCTTCTCCTCTTCGTCTTCACTATCTTTGCCTTCGCCGTCACCAACAAAGGCGTCGGAAAAGTTCTCTCGAACAGAGGATGTAAAGAGTACAGACTCAGTGATTACTCCAACTGGCTACAGAATCACGTCAGGAACAACAAAGATTGGAACAGAATCAAAAGCTGTTTAGTCGACGACAAGGTCTGTGCCGAATTCAACCAGAAATTCGCTTCTGAAACCATTGAGCAATTCTACCAAGAAGACTTATCTTCAATTCAAGTATGA ATGTTCCTTCTCATCCTTCTCCTCTTCGTCTTCACTATCTTTGCCTTCGCCGTCACCAACAAAGGCGTCGGAAAAGTTCTCTCGAACAGAGGATGTAAAGAGTACAGACTCAGTGATTACTCCAACTGGCTACAGAATCACGTCAGGAACAACAAAGATTGGAACAGAATCAAAAGCTGTTTAGTCGACGACAAGGTCTGTGCCGAATTCAACCAGAAATTCGCTTCTGAAACCATTGAGCAATTCTACCAAGAAGACTTATCTTCAATTCAAGTATGA MFLLILLLFVFTIFAFAVTNKGVGKVLSNRGCKEYRLSDYSNWLQNHVRNNKDWNRIKSCLVDDKVCAEFNQKFASETIEQFYQEDLSSIQV*
BLAST of MELO3C010577 vs. Swiss-Prot
Match: TET7_ARATH (Tetraspanin-7 OS=Arabidopsis thaliana GN=TET7 PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.8e-25 Identity = 52/91 (57.14%), Postives = 69/91 (75.82%), Query Frame = 1
BLAST of MELO3C010577 vs. Swiss-Prot
Match: TET8_ARATH (Tetraspanin-8 OS=Arabidopsis thaliana GN=TET8 PE=2 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 3.0e-25 Identity = 49/91 (53.85%), Postives = 65/91 (71.43%), Query Frame = 1
BLAST of MELO3C010577 vs. Swiss-Prot
Match: TET9_ARATH (Tetraspanin-9 OS=Arabidopsis thaliana GN=TET9 PE=2 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 5.0e-20 Identity = 44/91 (48.35%), Postives = 57/91 (62.64%), Query Frame = 1
BLAST of MELO3C010577 vs. Swiss-Prot
Match: TET11_ARATH (Tetraspanin-11 OS=Arabidopsis thaliana GN=TET11 PE=2 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 8.3e-15 Identity = 40/87 (45.98%), Postives = 52/87 (59.77%), Query Frame = 1
BLAST of MELO3C010577 vs. Swiss-Prot
Match: TET3_ARATH (Tetraspanin-3 OS=Arabidopsis thaliana GN=TET3 PE=2 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 5.3e-14 Identity = 38/93 (40.86%), Postives = 53/93 (56.99%), Query Frame = 1
BLAST of MELO3C010577 vs. TrEMBL
Match: A0A0A0LTZ1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G287020 PE=3 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 2.7e-36 Identity = 77/91 (84.62%), Postives = 80/91 (87.91%), Query Frame = 1
BLAST of MELO3C010577 vs. TrEMBL
Match: A0A0A0LJ53_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G037260 PE=3 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 2.2e-30 Identity = 61/91 (67.03%), Postives = 76/91 (83.52%), Query Frame = 1
BLAST of MELO3C010577 vs. TrEMBL
Match: V4UQY6_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10009180mg PE=3 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 2.4e-29 Identity = 61/91 (67.03%), Postives = 74/91 (81.32%), Query Frame = 1
BLAST of MELO3C010577 vs. TrEMBL
Match: A0A067F4S7_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g024170mg PE=3 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 2.4e-29 Identity = 61/91 (67.03%), Postives = 74/91 (81.32%), Query Frame = 1
BLAST of MELO3C010577 vs. TrEMBL
Match: A0A067KRN1_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_04110 PE=3 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 4.1e-29 Identity = 60/91 (65.93%), Postives = 75/91 (82.42%), Query Frame = 1
BLAST of MELO3C010577 vs. TAIR10
Match: AT4G28050.1 (AT4G28050.1 tetraspanin7) HSP 1 Score: 116.3 bits (290), Expect = 1.0e-26 Identity = 52/91 (57.14%), Postives = 69/91 (75.82%), Query Frame = 1
BLAST of MELO3C010577 vs. TAIR10
Match: AT2G23810.1 (AT2G23810.1 tetraspanin8) HSP 1 Score: 115.5 bits (288), Expect = 1.7e-26 Identity = 49/91 (53.85%), Postives = 65/91 (71.43%), Query Frame = 1
BLAST of MELO3C010577 vs. TAIR10
Match: AT4G30430.1 (AT4G30430.1 tetraspanin9) HSP 1 Score: 98.2 bits (243), Expect = 2.8e-21 Identity = 44/91 (48.35%), Postives = 57/91 (62.64%), Query Frame = 1
BLAST of MELO3C010577 vs. TAIR10
Match: AT1G18520.1 (AT1G18520.1 tetraspanin11) HSP 1 Score: 80.9 bits (198), Expect = 4.6e-16 Identity = 40/87 (45.98%), Postives = 52/87 (59.77%), Query Frame = 1
BLAST of MELO3C010577 vs. TAIR10
Match: AT3G45600.1 (AT3G45600.1 tetraspanin3) HSP 1 Score: 78.2 bits (191), Expect = 3.0e-15 Identity = 38/93 (40.86%), Postives = 53/93 (56.99%), Query Frame = 1
BLAST of MELO3C010577 vs. NCBI nr
Match: gi|659086205|ref|XP_008443811.1| (PREDICTED: tetraspanin-8-like [Cucumis melo]) HSP 1 Score: 169.5 bits (428), Expect = 2.8e-39 Identity = 82/91 (90.11%), Postives = 84/91 (92.31%), Query Frame = 1
BLAST of MELO3C010577 vs. NCBI nr
Match: gi|449466889|ref|XP_004151158.1| (PREDICTED: tetraspanin-8-like [Cucumis sativus]) HSP 1 Score: 159.1 bits (401), Expect = 3.8e-36 Identity = 77/91 (84.62%), Postives = 80/91 (87.91%), Query Frame = 1
BLAST of MELO3C010577 vs. NCBI nr
Match: gi|659124065|ref|XP_008461972.1| (PREDICTED: tetraspanin-8-like, partial [Cucumis melo]) HSP 1 Score: 152.5 bits (384), Expect = 3.6e-34 Identity = 73/91 (80.22%), Postives = 78/91 (85.71%), Query Frame = 1
BLAST of MELO3C010577 vs. NCBI nr
Match: gi|1009108597|ref|XP_015885487.1| (PREDICTED: tetraspanin-8-like [Ziziphus jujuba]) HSP 1 Score: 141.7 bits (356), Expect = 6.3e-31 Identity = 62/91 (68.13%), Postives = 77/91 (84.62%), Query Frame = 1
BLAST of MELO3C010577 vs. NCBI nr
Match: gi|449453924|ref|XP_004144706.1| (PREDICTED: tetraspanin-8-like [Cucumis sativus]) HSP 1 Score: 139.4 bits (350), Expect = 3.1e-30 Identity = 61/91 (67.03%), Postives = 76/91 (83.52%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|