MELO3C010378 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAGAATTTTTTTCTGGGGATAAGATTTTGTGTAAAAAGCCAGTTTATTATCGAACTGCTGAAGTTCCTGATATGTGGTTCTTGCCACAAGTTGTTTGGGAAATTAGAGGTGCAGACTTAACAGTATCGCCAGTTCACCAGGCTGCTGTAGGTTTAGTTCATCCTGTTCGTGGCATCTCAATCAGGTTTCCAAGATTTATTCGTTCGGTTCCGGATAGAAATCCTGAAGAATGTAGCACGGCTACAGATATAGCGGAAATGTTTAATTCTCAAACGAGGAAAATGGATGTTGCATCAGGAGGTTGA ATGAAAGAATTTTTTTCTGGGGATAAGATTTTGTGTAAAAAGCCAGTTTATTATCGAACTGCTGAAGTTCCTGATATGTGGTTCTTGCCACAAGTTGTTTGGGAAATTAGAGGTGCAGACTTAACAGTATCGCCAGTTCACCAGGCTGCTGTAGGTTTAGTTCATCCTGTTCGTGGCATCTCAATCAGGTTTCCAAGATTTATTCGTTCGGTTCCGGATAGAAATCCTGAAGAATGTAGCACGGCTACAGATATAGCGGAAATGTTTAATTCTCAAACGAGGAAAATGGATGTTGCATCAGGAGGTTGA ATGAAAGAATTTTTTTCTGGGGATAAGATTTTGTGTAAAAAGCCAGTTTATTATCGAACTGCTGAAGTTCCTGATATGTGGTTCTTGCCACAAGTTGTTTGGGAAATTAGAGGTGCAGACTTAACAGTATCGCCAGTTCACCAGGCTGCTGTAGGTTTAGTTCATCCTGTTCGTGGCATCTCAATCAGGTTTCCAAGATTTATTCGTTCGGTTCCGGATAGAAATCCTGAAGAATGTAGCACGGCTACAGATATAGCGGAAATGTTTAATTCTCAAACGAGGAAAATGGATGTTGCATCAGGAGGTTGA MKEFFSGDKILCKKPVYYRTAEVPDMWFLPQVVWEIRGADLTVSPVHQAAVGLVHPVRGISIRFPRFIRSVPDRNPEECSTATDIAEMFNSQTRKMDVASGG*
BLAST of MELO3C010378 vs. Swiss-Prot
Match: LIG6_ARATH (DNA ligase 6 OS=Arabidopsis thaliana GN=LIG6 PE=2 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 1.7e-40 Identity = 77/100 (77.00%), Postives = 84/100 (84.00%), Query Frame = 1
BLAST of MELO3C010378 vs. Swiss-Prot
Match: DNLI1_ARATH (DNA ligase 1 OS=Arabidopsis thaliana GN=LIG1 PE=2 SV=2) HSP 1 Score: 90.5 bits (223), Expect = 1.2e-17 Identity = 39/86 (45.35%), Postives = 58/86 (67.44%), Query Frame = 1
BLAST of MELO3C010378 vs. Swiss-Prot
Match: DNLI1_XENLA (DNA ligase 1 OS=Xenopus laevis GN=lig1 PE=2 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 7.5e-17 Identity = 42/98 (42.86%), Postives = 62/98 (63.27%), Query Frame = 1
BLAST of MELO3C010378 vs. Swiss-Prot
Match: DNLI_PICTO (DNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=lig PE=3 SV=2) HSP 1 Score: 87.0 bits (214), Expect = 1.3e-16 Identity = 38/91 (41.76%), Postives = 58/91 (63.74%), Query Frame = 1
BLAST of MELO3C010378 vs. Swiss-Prot
Match: DNLI1_DICDI (DNA ligase 1 OS=Dictyostelium discoideum GN=lig1 PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.7e-16 Identity = 34/69 (49.28%), Postives = 51/69 (73.91%), Query Frame = 1
BLAST of MELO3C010378 vs. TrEMBL
Match: V4T333_9ROSI (DNA ligase OS=Citrus clementina GN=CICLE_v10010910mg PE=3 SV=1) HSP 1 Score: 181.0 bits (458), Expect = 7.2e-43 Identity = 85/100 (85.00%), Postives = 91/100 (91.00%), Query Frame = 1
BLAST of MELO3C010378 vs. TrEMBL
Match: A0A0D2SFT5_GOSRA (DNA ligase OS=Gossypium raimondii GN=B456_007G185500 PE=3 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 1.2e-42 Identity = 82/100 (82.00%), Postives = 91/100 (91.00%), Query Frame = 1
BLAST of MELO3C010378 vs. TrEMBL
Match: A0A059BUJ7_EUCGR (DNA ligase OS=Eucalyptus grandis GN=EUGRSUZ_F02800 PE=3 SV=1) HSP 1 Score: 178.7 bits (452), Expect = 3.6e-42 Identity = 84/100 (84.00%), Postives = 92/100 (92.00%), Query Frame = 1
BLAST of MELO3C010378 vs. TrEMBL
Match: A0A0B0NW93_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_21615 PE=4 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 6.1e-42 Identity = 81/100 (81.00%), Postives = 91/100 (91.00%), Query Frame = 1
BLAST of MELO3C010378 vs. TrEMBL
Match: B9H345_POPTR (DNA ligase OS=Populus trichocarpa GN=POPTR_0004s09310g PE=3 SV=2) HSP 1 Score: 177.6 bits (449), Expect = 8.0e-42 Identity = 83/100 (83.00%), Postives = 88/100 (88.00%), Query Frame = 1
BLAST of MELO3C010378 vs. TAIR10
Match: AT1G66730.1 (AT1G66730.1 DNA LIGASE 6) HSP 1 Score: 166.4 bits (420), Expect = 9.3e-42 Identity = 77/100 (77.00%), Postives = 84/100 (84.00%), Query Frame = 1
BLAST of MELO3C010378 vs. TAIR10
Match: AT1G08130.1 (AT1G08130.1 DNA ligase 1) HSP 1 Score: 90.5 bits (223), Expect = 6.5e-19 Identity = 39/86 (45.35%), Postives = 58/86 (67.44%), Query Frame = 1
BLAST of MELO3C010378 vs. TAIR10
Match: AT1G49250.1 (AT1G49250.1 ATP-dependent DNA ligase) HSP 1 Score: 90.1 bits (222), Expect = 8.5e-19 Identity = 41/86 (47.67%), Postives = 57/86 (66.28%), Query Frame = 1
BLAST of MELO3C010378 vs. NCBI nr
Match: gi|659086673|ref|XP_008444062.1| (PREDICTED: DNA ligase 1 isoform X2 [Cucumis melo]) HSP 1 Score: 213.0 bits (541), Expect = 2.5e-52 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 1
BLAST of MELO3C010378 vs. NCBI nr
Match: gi|659086671|ref|XP_008444061.1| (PREDICTED: DNA ligase 1 isoform X1 [Cucumis melo]) HSP 1 Score: 213.0 bits (541), Expect = 2.5e-52 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 1
BLAST of MELO3C010378 vs. NCBI nr
Match: gi|568857253|ref|XP_006482181.1| (PREDICTED: DNA ligase 1 isoform X1 [Citrus sinensis]) HSP 1 Score: 181.0 bits (458), Expect = 1.0e-42 Identity = 85/100 (85.00%), Postives = 91/100 (91.00%), Query Frame = 1
BLAST of MELO3C010378 vs. NCBI nr
Match: gi|567876203|ref|XP_006430691.1| (hypothetical protein CICLE_v10010910mg [Citrus clementina]) HSP 1 Score: 181.0 bits (458), Expect = 1.0e-42 Identity = 85/100 (85.00%), Postives = 91/100 (91.00%), Query Frame = 1
BLAST of MELO3C010378 vs. NCBI nr
Match: gi|823191077|ref|XP_012491347.1| (PREDICTED: DNA ligase 1 isoform X1 [Gossypium raimondii]) HSP 1 Score: 180.3 bits (456), Expect = 1.8e-42 Identity = 82/100 (82.00%), Postives = 91/100 (91.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|