MELO3C010311.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTCATTATGGAAGAATGCCTTGTTGTATATCTGAGGCAGCAGGTAGATCTTTGAATCTCTTATGCTGAACTTTAGATTTATAGTGTGTGTGGTTGATATTTAGATGTTATCAATTAAACATAACTGTTGTAGGTGGATTACATTGGAAAACGTGTTTTTTTAAAGTTGATGAATGGGTGGAGATTGATGGATGAGCAGGCAGTCTTACACGCTATTTATTTGCTAGGATCAGGTATTTGTTAAGCATTCTATTGTATGATCCTGATTTAATTTTGCCAGTTTGTTTGCAGACCGTTGGCAATATCTTCATATTTTCAGGGGATCTTCGGCAGCACTTTAACT ATGGTCATTATGGAAGAATGCCTTGTTGTATATCTGAGGCAGCAGGTGGATTACATTGGAAAACGTGTTTTTTTAAAGTTGATGAATGGGTGGAGATTGATGGATGAGCAGGCAGTCTTACACGCTATTTATTTGCTAGGATCAGGGGATCTTCGGCAGCACTTTAACT ATGGTCATTATGGAAGAATGCCTTGTTGTATATCTGAGGCAGCAGGTGGATTACATTGGAAAACGTGTTTTTTTAAAGTTGATGAATGGGTGGAGATTGATGGATGAGCAGGCAGTCTTACACGCTATTTATTTGCTAGGATCAGGGGATCTTCGGCAGCACTTTAAC MVIMEECLVVYLRQQVDYIGKRVFLKLMNGWRLMDEQAVLHAIYLLGSGDLRQHFN
BLAST of MELO3C010311.2 vs. NCBI nr
Match: XP_022136607.1 (gamma-tubulin complex component 5-like [Momordica charantia]) HSP 1 Score: 97.4 bits (241), Expect = 1.6e-17 Identity = 49/55 (89.09%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MELO3C010311.2 vs. NCBI nr
Match: XP_022975992.1 (gamma-tubulin complex component 5-like [Cucurbita maxima]) HSP 1 Score: 97.4 bits (241), Expect = 1.6e-17 Identity = 49/55 (89.09%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MELO3C010311.2 vs. NCBI nr
Match: XP_008452496.1 (PREDICTED: gamma-tubulin complex component 5-like isoform X1 [Cucumis melo]) HSP 1 Score: 96.7 bits (239), Expect = 2.7e-17 Identity = 47/55 (85.45%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MELO3C010311.2 vs. NCBI nr
Match: XP_008452497.1 (PREDICTED: gamma-tubulin complex component 5-like isoform X2 [Cucumis melo]) HSP 1 Score: 96.7 bits (239), Expect = 2.7e-17 Identity = 47/55 (85.45%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MELO3C010311.2 vs. NCBI nr
Match: XP_008452498.1 (PREDICTED: gamma-tubulin complex component 5-like isoform X3 [Cucumis melo]) HSP 1 Score: 96.7 bits (239), Expect = 2.7e-17 Identity = 47/55 (85.45%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MELO3C010311.2 vs. TAIR10
Match: AT1G80260.1 (Spc97 / Spc98 family of spindle pole body (SBP) component) HSP 1 Score: 82.0 bits (201), Expect = 1.3e-16 Identity = 38/55 (69.09%), Postives = 45/55 (81.82%), Query Frame = 0
BLAST of MELO3C010311.2 vs. TAIR10
Match: AT1G20570.1 (Spc97 / Spc98 family of spindle pole body (SBP) component) HSP 1 Score: 74.7 bits (182), Expect = 2.0e-14 Identity = 36/55 (65.45%), Postives = 43/55 (78.18%), Query Frame = 0
BLAST of MELO3C010311.2 vs. TrEMBL
Match: tr|A0A1S3BU00|A0A1S3BU00_CUCME (Gamma-tubulin complex component OS=Cucumis melo OX=3656 GN=LOC103493512 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.8e-17 Identity = 47/55 (85.45%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MELO3C010311.2 vs. TrEMBL
Match: tr|A0A1S3BTD0|A0A1S3BTD0_CUCME (Gamma-tubulin complex component OS=Cucumis melo OX=3656 GN=LOC103493512 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.8e-17 Identity = 47/55 (85.45%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MELO3C010311.2 vs. TrEMBL
Match: tr|A0A1S3BV48|A0A1S3BV48_CUCME (Gamma-tubulin complex component OS=Cucumis melo OX=3656 GN=LOC103493512 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.8e-17 Identity = 47/55 (85.45%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MELO3C010311.2 vs. TrEMBL
Match: tr|A0A0A0L296|A0A0A0L296_CUCSA (Gamma-tubulin complex component OS=Cucumis sativus OX=3659 GN=Csa_4G638490 PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 4.0e-17 Identity = 48/55 (87.27%), Postives = 48/55 (87.27%), Query Frame = 0
BLAST of MELO3C010311.2 vs. TrEMBL
Match: tr|A0A061FRW9|A0A061FRW9_THECC (Gamma-tubulin complex component OS=Theobroma cacao OX=3641 GN=TCM_044506 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.9e-15 Identity = 42/55 (76.36%), Postives = 47/55 (85.45%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |