MELO3C010209 (gene) Melon (DHL92) v3.5.1

NameMELO3C010209
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
DescriptionPutative 3-methyladenine DNA glycosylase
Locationchr2 : 14603630 .. 14603914 (-)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGAGCATCGTATAAGAGTCAAAAATTCACAAGAACATCGCAAACACAAACGCTATGTTGAAACAAATCAAAGAGCCGACATTAAAGAACGACGACGACATTTGGGCGGACGACGACGAAGTCGAACGACCTGCAGTTACGCCGGACCGAACTCCTCTTTTACTAATGATCTTTCCGGCCAAGGAGGTGTCGGAACCCTTGTCCCCTCGCCGATTAGAATTCTGGCCATGATCGGTAGAGGAGATGGCTGCGAGAGATTCAGAGAAAAGGAGAAGAGAAATTAG

mRNA sequence

ATGGAGCATCGTATAAGAGTCAAAAATTCACAAGAACATCGCAAACACAAACGCTATGTTGAAACAAATCAAAGAGCCGACATTAAAGAACGACGACGACATTTGGGCGGACGACGACGAAGTCGAACGACCTGCAGTTACGCCGGACCGAACTCCTCTTTTACTAATGATCTTTCCGGCCAAGGAGGTGTCGGAACCCTTGTCCCCTCGCCGATTAGAATTCTGGCCATGATCGGTAGAGGAGATGGCTGCGAGAGATTCAGAGAAAAGGAGAAGAGAAATTAG

Coding sequence (CDS)

ATGGAGCATCGTATAAGAGTCAAAAATTCACAAGAACATCGCAAACACAAACGCTATGTTGAAACAAATCAAAGAGCCGACATTAAAGAACGACGACGACATTTGGGCGGACGACGACGAAGTCGAACGACCTGCAGTTACGCCGGACCGAACTCCTCTTTTACTAATGATCTTTCCGGCCAAGGAGGTGTCGGAACCCTTGTCCCCTCGCCGATTAGAATTCTGGCCATGATCGGTAGAGGAGATGGCTGCGAGAGATTCAGAGAAAAGGAGAAGAGAAATTAG

Protein sequence

MEHRIRVKNSQEHRKHKRYVETNQRADIKERRRHLGGRRRSRTTCSYAGPNSSFTNDLSGQGGVGTLVPSPIRILAMIGRGDGCERFREKEKRN*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function
This gene is associated with the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
MU47373melon EST collection version 4.0transcribed_cluster

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C010209T1MELO3C010209T1mRNA


The following transcribed_cluster feature(s) are associated with this gene:

Feature NameUnique NameType
MU47373MU47373transcribed_cluster


The following gene(s) are orthologous to this gene:
GeneOrthologueOrganismBlock
MELO3C010209ClCG06G012530Watermelon (Charleston Gray)mewcgB258
MELO3C010209Cucsa.170660Cucumber (Gy14) v1cgymeB304
The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C010209Silver-seed gourdcarmeB0131
MELO3C010209Silver-seed gourdcarmeB0509
MELO3C010209Silver-seed gourdcarmeB0898
MELO3C010209Cucumber (Chinese Long) v3cucmeB054
MELO3C010209Cucumber (Chinese Long) v3cucmeB118
MELO3C010209Cucumber (Chinese Long) v3cucmeB285
MELO3C010209Watermelon (97103) v2mewmbB259
MELO3C010209Watermelon (97103) v2mewmbB265
MELO3C010209Wax gourdmewgoB266
MELO3C010209Wax gourdmewgoB290
MELO3C010209Melon (DHL92) v3.5.1memeB108
MELO3C010209Melon (DHL92) v3.5.1memeB116
MELO3C010209Cucurbita moschata (Rifu)cmomeB098
MELO3C010209Cucumber (Gy14) v1cgymeB101
MELO3C010209Cucumber (Gy14) v1cgymeB452
MELO3C010209Cucurbita maxima (Rimu)cmameB058
MELO3C010209Cucurbita maxima (Rimu)cmameB105
MELO3C010209Cucurbita maxima (Rimu)cmameB154
MELO3C010209Cucurbita moschata (Rifu)cmomeB049
MELO3C010209Cucurbita moschata (Rifu)cmomeB144
MELO3C010209Wild cucumber (PI 183967)cpimeB057
MELO3C010209Wild cucumber (PI 183967)cpimeB112
MELO3C010209Wild cucumber (PI 183967)cpimeB279
MELO3C010209Cucumber (Chinese Long) v2cumeB060
MELO3C010209Cucumber (Chinese Long) v2cumeB113
MELO3C010209Cucumber (Chinese Long) v2cumeB289
MELO3C010209Watermelon (Charleston Gray)mewcgB253
MELO3C010209Watermelon (97103) v1mewmB278
MELO3C010209Watermelon (97103) v1mewmB293
MELO3C010209Cucurbita pepo (Zucchini)cpemeB334
MELO3C010209Cucurbita pepo (Zucchini)cpemeB621
MELO3C010209Cucurbita pepo (Zucchini)cpemeB752
MELO3C010209Bottle gourd (USVL1VR-Ls)lsimeB104
MELO3C010209Bottle gourd (USVL1VR-Ls)lsimeB402
MELO3C010209Bottle gourd (USVL1VR-Ls)lsimeB404
MELO3C010209Cucumber (Gy14) v2cgybmeB049
MELO3C010209Cucumber (Gy14) v2cgybmeB057
MELO3C010209Cucumber (Gy14) v2cgybmeB097