MELO3C010192 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGTTTGGGAAATACCTCTTGGGGCTCAAGTCATATGTTTCTCAGACTAAGACAGGTGTTGAAATATTTGCTATTGGAGACCATATATTAGGAATTCAAGGCCACCCTGAGTATTCTAAAGACATTCTTTACAATCTCGTGGATCGCCTCGCCAATAATGACACTATACAGGTCACTATTCTAATTTACCCAATCCTAAATTATCAGCAAATATTTATAATTTCATTTTAATTTTCTTTTACCTTGAAACTTCTGATTGAAGTTTTTGGACTTTTGAAGAGGGAATTTGCTGAAGACGCAAAGGTATGTATACAAGCTGCAGAACCAGATACAAAGTGGTGGAAGAAGATCTGCAACAATTTTCTCAAAGGATGA ATGAAGTTTGGGAAATACCTCTTGGGGCTCAAGTCATATGTTTCTCAGACTAAGACAGGTGTTGAAATATTTGCTATTGGAGACCATATATTAGGAATTCAAGGCCACCCTGAGTATTCTAAAGACATTCTTTACAATCTCGTGGATCGCCTCGCCAATAATGACACTATACAGAGGGAATTTGCTGAAGACGCAAAGGTATGTATACAAGCTGCAGAACCAGATACAAAGTGGTGGAAGAAGATCTGCAACAATTTTCTCAAAGGATGA ATGAAGTTTGGGAAATACCTCTTGGGGCTCAAGTCATATGTTTCTCAGACTAAGACAGGTGTTGAAATATTTGCTATTGGAGACCATATATTAGGAATTCAAGGCCACCCTGAGTATTCTAAAGACATTCTTTACAATCTCGTGGATCGCCTCGCCAATAATGACACTATACAGAGGGAATTTGCTGAAGACGCAAAGGTATGTATACAAGCTGCAGAACCAGATACAAAGTGGTGGAAGAAGATCTGCAACAATTTTCTCAAAGGATGA MKFGKYLLGLKSYVSQTKTGVEIFAIGDHILGIQGHPEYSKDILYNLVDRLANNDTIQREFAEDAKVCIQAAEPDTKWWKKICNNFLKG*
BLAST of MELO3C010192 vs. Swiss-Prot
Match: GGP5_ARATH (Gamma-glutamyl peptidase 5 OS=Arabidopsis thaliana GN=GGP5 PE=2 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 6.5e-17 Identity = 36/72 (50.00%), Postives = 53/72 (73.61%), Query Frame = 1
BLAST of MELO3C010192 vs. Swiss-Prot
Match: GGP3_ARATH (Gamma-glutamyl peptidase 3 OS=Arabidopsis thaliana GN=GGP3 PE=2 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 8.5e-17 Identity = 37/69 (53.62%), Postives = 51/69 (73.91%), Query Frame = 1
BLAST of MELO3C010192 vs. Swiss-Prot
Match: GGP4_ARATH (Gamma-glutamyl peptidase 4 OS=Arabidopsis thaliana GN=GGP4 PE=3 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 8.8e-14 Identity = 33/68 (48.53%), Postives = 49/68 (72.06%), Query Frame = 1
BLAST of MELO3C010192 vs. Swiss-Prot
Match: GGP1_ARATH (Gamma-glutamyl peptidase 1 OS=Arabidopsis thaliana GN=GGP1 PE=1 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 4.4e-13 Identity = 33/69 (47.83%), Postives = 47/69 (68.12%), Query Frame = 1
BLAST of MELO3C010192 vs. Swiss-Prot
Match: GGP2_ARATH (Gamma-glutamyl peptidase 2 OS=Arabidopsis thaliana GN=GGP2 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.7e-12 Identity = 34/72 (47.22%), Postives = 45/72 (62.50%), Query Frame = 1
BLAST of MELO3C010192 vs. TrEMBL
Match: A0A0A0LTK0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G275940 PE=4 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 1.6e-33 Identity = 72/87 (82.76%), Postives = 74/87 (85.06%), Query Frame = 1
BLAST of MELO3C010192 vs. TrEMBL
Match: V4U1T5_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10009284mg PE=4 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.0e-24 Identity = 54/72 (75.00%), Postives = 64/72 (88.89%), Query Frame = 1
BLAST of MELO3C010192 vs. TrEMBL
Match: A0A067F853_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g025645mg PE=4 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.0e-24 Identity = 54/72 (75.00%), Postives = 64/72 (88.89%), Query Frame = 1
BLAST of MELO3C010192 vs. TrEMBL
Match: D7U1H2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_11s0037g00890 PE=4 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 8.6e-24 Identity = 54/82 (65.85%), Postives = 64/82 (78.05%), Query Frame = 1
BLAST of MELO3C010192 vs. TrEMBL
Match: A0A061GWM5_THECC (Class I glutamine amidotransferase-like superfamily protein OS=Theobroma cacao GN=TCM_038445 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.5e-23 Identity = 53/81 (65.43%), Postives = 66/81 (81.48%), Query Frame = 1
BLAST of MELO3C010192 vs. TAIR10
Match: AT2G23970.1 (AT2G23970.1 Class I glutamine amidotransferase-like superfamily protein) HSP 1 Score: 87.8 bits (216), Expect = 3.7e-18 Identity = 36/72 (50.00%), Postives = 53/72 (73.61%), Query Frame = 1
BLAST of MELO3C010192 vs. TAIR10
Match: AT4G30550.1 (AT4G30550.1 Class I glutamine amidotransferase-like superfamily protein) HSP 1 Score: 87.4 bits (215), Expect = 4.8e-18 Identity = 37/69 (53.62%), Postives = 51/69 (73.91%), Query Frame = 1
BLAST of MELO3C010192 vs. TAIR10
Match: AT2G23960.1 (AT2G23960.1 Class I glutamine amidotransferase-like superfamily protein) HSP 1 Score: 77.4 bits (189), Expect = 5.0e-15 Identity = 33/68 (48.53%), Postives = 49/68 (72.06%), Query Frame = 1
BLAST of MELO3C010192 vs. TAIR10
Match: AT4G30530.1 (AT4G30530.1 Class I glutamine amidotransferase-like superfamily protein) HSP 1 Score: 75.1 bits (183), Expect = 2.5e-14 Identity = 33/69 (47.83%), Postives = 47/69 (68.12%), Query Frame = 1
BLAST of MELO3C010192 vs. TAIR10
Match: AT4G30540.1 (AT4G30540.1 Class I glutamine amidotransferase-like superfamily protein) HSP 1 Score: 73.2 bits (178), Expect = 9.4e-14 Identity = 34/72 (47.22%), Postives = 45/72 (62.50%), Query Frame = 1
BLAST of MELO3C010192 vs. NCBI nr
Match: gi|449457859|ref|XP_004146665.1| (PREDICTED: putative glutamine amidotransferase YLR126C [Cucumis sativus]) HSP 1 Score: 149.8 bits (377), Expect = 2.2e-33 Identity = 72/87 (82.76%), Postives = 74/87 (85.06%), Query Frame = 1
BLAST of MELO3C010192 vs. NCBI nr
Match: gi|641843410|gb|KDO62310.1| (hypothetical protein CISIN_1g025645mg [Citrus sinensis]) HSP 1 Score: 120.6 bits (301), Expect = 1.5e-24 Identity = 54/72 (75.00%), Postives = 64/72 (88.89%), Query Frame = 1
BLAST of MELO3C010192 vs. NCBI nr
Match: gi|567923074|ref|XP_006453543.1| (hypothetical protein CICLE_v10009284mg [Citrus clementina]) HSP 1 Score: 120.6 bits (301), Expect = 1.5e-24 Identity = 54/72 (75.00%), Postives = 64/72 (88.89%), Query Frame = 1
BLAST of MELO3C010192 vs. NCBI nr
Match: gi|1009109643|ref|XP_015891252.1| (PREDICTED: gamma-glutamyl peptidase 5-like isoform X1 [Ziziphus jujuba]) HSP 1 Score: 118.6 bits (296), Expect = 5.5e-24 Identity = 55/82 (67.07%), Postives = 64/82 (78.05%), Query Frame = 1
BLAST of MELO3C010192 vs. NCBI nr
Match: gi|720095096|ref|XP_010246569.1| (PREDICTED: putative glutamine amidotransferase YLR126C [Nelumbo nucifera]) HSP 1 Score: 117.9 bits (294), Expect = 9.4e-24 Identity = 52/82 (63.41%), Postives = 68/82 (82.93%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |