MELO3C010130.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATAGTTTAAAAATGTCATTTGTAAAAATGATGACCGATGATGCCCAAACTTTGCAGAAAGAGCGGTGCTTCCGGTTGTGGGTCAATAGTCTTGGCATAGCCACATATGTCAACAATGTCTTTGAGAATGTGAGAAACGGGTATTATTTTTTGTTTTACTTTAACTTATGAATCAACTGTATATTGTCCTTTTTTTTTACAAGCTTAAGATACGACGTCCATATTATAGATGGGTTCTTTTGGAAGTTCTTGACAAAGTTTTTCCTTGA ATGGATAGTTTAAAAATGTCATTTGTAAAAATGATGACCGATGATGCCCAAACTTTGCAGAAAGAGCGGTGCTTCCGGTTGTGGGTCAATAGTCTTGGCATAGCCACATATGTCAACAATGTCTTTGAGAATGTGAGAAACGGATGGGTTCTTTTGGAAGTTCTTGACAAAGTTTTTCCTTGA ATGGATAGTTTAAAAATGTCATTTGTAAAAATGATGACCGATGATGCCCAAACTTTGCAGAAAGAGCGGTGCTTCCGGTTGTGGGTCAATAGTCTTGGCATAGCCACATATGTCAACAATGTCTTTGAGAATGTGAGAAACGGATGGGTTCTTTTGGAAGTTCTTGACAAAGTTTTTCCTTGA MDSLKMSFVKMMTDDAQTLQKERCFRLWVNSLGIATYVNNVFENVRNGWVLLEVLDKVFP
BLAST of MELO3C010130.2 vs. NCBI nr
Match: XP_004144532.1 (PREDICTED: fimbrin-5 [Cucumis sativus] >KGN43448.1 hypothetical protein Csa_7G037520 [Cucumis sativus]) HSP 1 Score: 108.2 bits (269), Expect = 9.7e-21 Identity = 50/60 (83.33%), Postives = 56/60 (93.33%), Query Frame = 0
BLAST of MELO3C010130.2 vs. NCBI nr
Match: XP_008455508.1 (PREDICTED: fimbrin-5 [Cucumis melo] >XP_016901751.1 PREDICTED: fimbrin-5 [Cucumis melo] >XP_016901752.1 PREDICTED: fimbrin-5 [Cucumis melo]) HSP 1 Score: 108.2 bits (269), Expect = 9.7e-21 Identity = 50/60 (83.33%), Postives = 56/60 (93.33%), Query Frame = 0
BLAST of MELO3C010130.2 vs. NCBI nr
Match: XP_007142522.1 (hypothetical protein PHAVU_008G287800g [Phaseolus vulgaris] >ESW14516.1 hypothetical protein PHAVU_008G287800g [Phaseolus vulgaris]) HSP 1 Score: 107.1 bits (266), Expect = 2.2e-20 Identity = 49/60 (81.67%), Postives = 56/60 (93.33%), Query Frame = 0
BLAST of MELO3C010130.2 vs. NCBI nr
Match: XP_003545629.2 (fimbrin-5 [Glycine max] >KRH14073.1 hypothetical protein GLYMA_14G005200 [Glycine max]) HSP 1 Score: 107.1 bits (266), Expect = 2.2e-20 Identity = 49/60 (81.67%), Postives = 56/60 (93.33%), Query Frame = 0
BLAST of MELO3C010130.2 vs. NCBI nr
Match: KHN46900.1 (Fimbrin-like protein 2 [Glycine soja]) HSP 1 Score: 107.1 bits (266), Expect = 2.2e-20 Identity = 49/60 (81.67%), Postives = 56/60 (93.33%), Query Frame = 0
BLAST of MELO3C010130.2 vs. TAIR10
Match: AT5G35700.1 (fimbrin-like protein 2) HSP 1 Score: 98.6 bits (244), Expect = 1.4e-21 Identity = 44/60 (73.33%), Postives = 52/60 (86.67%), Query Frame = 0
BLAST of MELO3C010130.2 vs. TAIR10
Match: AT5G55400.1 (Actin binding Calponin homology (CH) domain-containing protein) HSP 1 Score: 94.0 bits (232), Expect = 3.4e-20 Identity = 39/56 (69.64%), Postives = 50/56 (89.29%), Query Frame = 0
BLAST of MELO3C010130.2 vs. TAIR10
Match: AT4G26700.1 (fimbrin 1) HSP 1 Score: 91.7 bits (226), Expect = 1.7e-19 Identity = 39/56 (69.64%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of MELO3C010130.2 vs. TAIR10
Match: AT2G04750.1 (Actin binding Calponin homology (CH) domain-containing protein) HSP 1 Score: 84.0 bits (206), Expect = 3.5e-17 Identity = 37/55 (67.27%), Postives = 47/55 (85.45%), Query Frame = 0
BLAST of MELO3C010130.2 vs. TAIR10
Match: AT5G48460.1 (Actin binding Calponin homology (CH) domain-containing protein) HSP 1 Score: 69.3 bits (168), Expect = 9.0e-13 Identity = 27/56 (48.21%), Postives = 43/56 (76.79%), Query Frame = 0
BLAST of MELO3C010130.2 vs. Swiss-Prot
Match: sp|Q9FKI0|FIMB5_ARATH (Fimbrin-5 OS=Arabidopsis thaliana OX=3702 GN=FIM5 PE=1 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 2.5e-20 Identity = 44/60 (73.33%), Postives = 52/60 (86.67%), Query Frame = 0
BLAST of MELO3C010130.2 vs. Swiss-Prot
Match: sp|Q9FJ70|FIMB3_ARATH (Fimbrin-3 OS=Arabidopsis thaliana OX=3702 GN=FIM3 PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 6.2e-19 Identity = 39/56 (69.64%), Postives = 50/56 (89.29%), Query Frame = 0
BLAST of MELO3C010130.2 vs. Swiss-Prot
Match: sp|Q7G188|FIMB1_ARATH (Fimbrin-1 OS=Arabidopsis thaliana OX=3702 GN=FIM1 PE=1 SV=2) HSP 1 Score: 91.7 bits (226), Expect = 3.1e-18 Identity = 39/56 (69.64%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of MELO3C010130.2 vs. Swiss-Prot
Match: sp|Q9SJ84|FIMB4_ARATH (Fimbrin-4 OS=Arabidopsis thaliana OX=3702 GN=FIM4 PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 6.4e-16 Identity = 37/55 (67.27%), Postives = 47/55 (85.45%), Query Frame = 0
BLAST of MELO3C010130.2 vs. Swiss-Prot
Match: sp|O50064|FIMB2_ARATH (Fimbrin-2 OS=Arabidopsis thaliana OX=3702 GN=FIM2 PE=2 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 1.6e-11 Identity = 27/56 (48.21%), Postives = 43/56 (76.79%), Query Frame = 0
BLAST of MELO3C010130.2 vs. TrEMBL
Match: tr|A0A1S4E0J8|A0A1S4E0J8_CUCME (fimbrin-5 OS=Cucumis melo OX=3656 GN=LOC103495662 PE=4 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 6.4e-21 Identity = 50/60 (83.33%), Postives = 56/60 (93.33%), Query Frame = 0
BLAST of MELO3C010130.2 vs. TrEMBL
Match: tr|A0A0A0K1W9|A0A0A0K1W9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G037520 PE=4 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 6.4e-21 Identity = 50/60 (83.33%), Postives = 56/60 (93.33%), Query Frame = 0
BLAST of MELO3C010130.2 vs. TrEMBL
Match: tr|I1M675|I1M675_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=100818651 PE=4 SV=2) HSP 1 Score: 107.1 bits (266), Expect = 1.4e-20 Identity = 49/60 (81.67%), Postives = 56/60 (93.33%), Query Frame = 0
BLAST of MELO3C010130.2 vs. TrEMBL
Match: tr|A0A0B2SPQ5|A0A0B2SPQ5_GLYSO (Fimbrin-like protein 2 OS=Glycine soja OX=3848 GN=glysoja_031200 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.4e-20 Identity = 49/60 (81.67%), Postives = 56/60 (93.33%), Query Frame = 0
BLAST of MELO3C010130.2 vs. TrEMBL
Match: tr|V7BDG6|V7BDG6_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris OX=3885 GN=PHAVU_008G287800g PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.4e-20 Identity = 49/60 (81.67%), Postives = 56/60 (93.33%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|