MELO3C010079 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTCAAGAATAAAGGATTCCTTCCATCAGGACCTTCAGAGATACATGCCCAACGAAATCATTTGAAGGATATTATTTTCTCATTACTTCCTGCATGCCAGGATGATGATCCAGAATCAAACATTCCATTTAAGGCAGATGCGATAATTGCTAATCCCCCTGCATATG ATGGTCAAGAATAAAGGATTCCTTCCATCAGGACCTTCAGAGATACATGCCCAACGAAATCATTTGAAGGATATTATTTTCTCATTACTTCCTGCATGCCAGGATGATGATCCAGAATCAAACATTCCATTTAAGGCAGATGCGATAATTGCTAATCCCCCTGCATATG ATGGTCAAGAATAAAGGATTCCTTCCATCAGGACCTTCAGAGATACATGCCCAACGAAATCATTTGAAGGATATTATTTTCTCATTACTTCCTGCATGCCAGGATGATGATCCAGAATCAAACATTCCATTTAAGGCAGATGCGATAATTGCTAATCCCCCTGCATATG MVKNKGFLPSGPSEIHAQRNHLKDIIFSLLPACQDDDPESNIPFKADAIIANPPAY
BLAST of MELO3C010079 vs. Swiss-Prot
Match: U80A2_ARATH (Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana GN=UGT80A2 PE=1 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 8.8e-20 Identity = 45/56 (80.36%), Postives = 48/56 (85.71%), Query Frame = 1
BLAST of MELO3C010079 vs. Swiss-Prot
Match: U80B1_ARATH (Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana GN=UGT80B1 PE=2 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.4e-12 Identity = 36/56 (64.29%), Postives = 39/56 (69.64%), Query Frame = 1
BLAST of MELO3C010079 vs. TrEMBL
Match: A0A0A0LXW5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G661230 PE=4 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 5.3e-24 Identity = 55/56 (98.21%), Postives = 55/56 (98.21%), Query Frame = 1
BLAST of MELO3C010079 vs. TrEMBL
Match: S8CBZ5_9LAMI (Sterol 3-beta-glucosyltransferase (Fragment) OS=Genlisea aurea GN=M569_10396 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 1.8e-19 Identity = 46/56 (82.14%), Postives = 51/56 (91.07%), Query Frame = 1
BLAST of MELO3C010079 vs. TrEMBL
Match: A0A059D2A3_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_B01378 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 5.2e-19 Identity = 45/56 (80.36%), Postives = 52/56 (92.86%), Query Frame = 1
BLAST of MELO3C010079 vs. TrEMBL
Match: M5WHU1_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa019814mg PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 1.5e-18 Identity = 45/56 (80.36%), Postives = 51/56 (91.07%), Query Frame = 1
BLAST of MELO3C010079 vs. TrEMBL
Match: K4BS77_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 2.0e-18 Identity = 45/56 (80.36%), Postives = 50/56 (89.29%), Query Frame = 1
BLAST of MELO3C010079 vs. TAIR10
Match: AT3G07020.2 (AT3G07020.2 UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 96.7 bits (239), Expect = 4.9e-21 Identity = 45/56 (80.36%), Postives = 48/56 (85.71%), Query Frame = 1
BLAST of MELO3C010079 vs. TAIR10
Match: AT1G43620.1 (AT1G43620.1 UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 72.8 bits (177), Expect = 7.6e-14 Identity = 36/56 (64.29%), Postives = 39/56 (69.64%), Query Frame = 1
BLAST of MELO3C010079 vs. NCBI nr
Match: gi|659086031|ref|XP_008443730.1| (PREDICTED: sterol 3-beta-glucosyltransferase UGT80A2-like isoform X1 [Cucumis melo]) HSP 1 Score: 119.8 bits (299), Expect = 1.5e-24 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 1
BLAST of MELO3C010079 vs. NCBI nr
Match: gi|659086033|ref|XP_008443731.1| (PREDICTED: sterol 3-beta-glucosyltransferase UGT80A2-like isoform X2 [Cucumis melo]) HSP 1 Score: 119.8 bits (299), Expect = 1.5e-24 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 1
BLAST of MELO3C010079 vs. NCBI nr
Match: gi|778664181|ref|XP_011660238.1| (PREDICTED: sterol 3-beta-glucosyltransferase UGT80A2-like isoform X1 [Cucumis sativus]) HSP 1 Score: 117.5 bits (293), Expect = 7.7e-24 Identity = 55/56 (98.21%), Postives = 55/56 (98.21%), Query Frame = 1
BLAST of MELO3C010079 vs. NCBI nr
Match: gi|700211609|gb|KGN66705.1| (hypothetical protein Csa_1G661230 [Cucumis sativus]) HSP 1 Score: 117.5 bits (293), Expect = 7.7e-24 Identity = 55/56 (98.21%), Postives = 55/56 (98.21%), Query Frame = 1
BLAST of MELO3C010079 vs. NCBI nr
Match: gi|778664184|ref|XP_011660239.1| (PREDICTED: sterol 3-beta-glucosyltransferase UGT80A2-like isoform X2 [Cucumis sativus]) HSP 1 Score: 117.5 bits (293), Expect = 7.7e-24 Identity = 55/56 (98.21%), Postives = 55/56 (98.21%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|