MELO3C009936 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTAAGGCGGAGTGCGCCACCGTCGGCTCCAACACCGGCTTCAAAGCCGCCACAGCTCGAGGCCTCAGCTACTATGTCTTCACCCTCTACGTTTGCATCGTCGCGGCCGCCGCCCTCATCCCTTTCGCCTTATTCTTCCATAAGTAA ATGGTTAAGGCGGAGTGCGCCACCGTCGGCTCCAACACCGGCTTCAAAGCCGCCACAGCTCGAGGCCTCAGCTACTATGTCTTCACCCTCTACGTTTGCATCGTCGCGGCCGCCGCCCTCATCCCTTTCGCCTTATTCTTCCATAAGTAA ATGGTTAAGGCGGAGTGCGCCACCGTCGGCTCCAACACCGGCTTCAAAGCCGCCACAGCTCGAGGCCTCAGCTACTATGTCTTCACCCTCTACGTTTGCATCGTCGCGGCCGCCGCCCTCATCCCTTTCGCCTTATTCTTCCATAAGTAA MVKAECATVGSNTGFKAATARGLSYYVFTLYVCIVAAAALIPFALFFHK*
BLAST of MELO3C009936 vs. Swiss-Prot
Match: WTR41_ARATH (WAT1-related protein At5g40230 OS=Arabidopsis thaliana GN=At5g40230 PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 2.1e-09 Identity = 29/47 (61.70%), Postives = 31/47 (65.96%), Query Frame = 1
BLAST of MELO3C009936 vs. Swiss-Prot
Match: WTR42_ARATH (WAT1-related protein At5g40240 OS=Arabidopsis thaliana GN=At5g40240 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 2.4e-08 Identity = 28/47 (59.57%), Postives = 31/47 (65.96%), Query Frame = 1
BLAST of MELO3C009936 vs. TrEMBL
Match: A0A0A0LC97_CUCSA (WAT1-related protein OS=Cucumis sativus GN=Csa_3G835770 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 8.1e-16 Identity = 45/49 (91.84%), Postives = 45/49 (91.84%), Query Frame = 1
BLAST of MELO3C009936 vs. TrEMBL
Match: A0A0A0LHW6_CUCSA (WAT1-related protein OS=Cucumis sativus GN=Csa_3G835780 PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 2.8e-08 Identity = 28/49 (57.14%), Postives = 36/49 (73.47%), Query Frame = 1
BLAST of MELO3C009936 vs. TrEMBL
Match: V4LWV7_EUTSA (WAT1-related protein OS=Eutrema salsugineum GN=EUTSA_v10027813mg PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 1.8e-07 Identity = 29/47 (61.70%), Postives = 34/47 (72.34%), Query Frame = 1
BLAST of MELO3C009936 vs. TrEMBL
Match: A0A0D3CT14_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=4 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 3.1e-07 Identity = 29/49 (59.18%), Postives = 34/49 (69.39%), Query Frame = 1
BLAST of MELO3C009936 vs. TrEMBL
Match: A0A0D3CT14_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=4 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 9.0e-07 Identity = 28/47 (59.57%), Postives = 33/47 (70.21%), Query Frame = 1
HSP 2 Score: 61.6 bits (148), Expect = 3.1e-07 Identity = 29/49 (59.18%), Postives = 34/49 (69.39%), Query Frame = 1
BLAST of MELO3C009936 vs. TAIR10
Match: AT5G40230.1 (AT5G40230.1 nodulin MtN21 /EamA-like transporter family protein) HSP 1 Score: 62.0 bits (149), Expect = 1.2e-10 Identity = 29/47 (61.70%), Postives = 31/47 (65.96%), Query Frame = 1
BLAST of MELO3C009936 vs. TAIR10
Match: AT5G40240.2 (AT5G40240.2 nodulin MtN21 /EamA-like transporter family protein) HSP 1 Score: 58.5 bits (140), Expect = 1.3e-09 Identity = 28/47 (59.57%), Postives = 31/47 (65.96%), Query Frame = 1
BLAST of MELO3C009936 vs. TAIR10
Match: AT4G15540.1 (AT4G15540.1 EamA-like transporter family) HSP 1 Score: 47.8 bits (112), Expect = 2.3e-06 Identity = 22/47 (46.81%), Postives = 27/47 (57.45%), Query Frame = 1
BLAST of MELO3C009936 vs. NCBI nr
Match: gi|659085554|ref|XP_008443482.1| (PREDICTED: WAT1-related protein At4g15540-like isoform X1 [Cucumis melo]) HSP 1 Score: 97.1 bits (240), Expect = 9.6e-18 Identity = 47/49 (95.92%), Postives = 47/49 (95.92%), Query Frame = 1
BLAST of MELO3C009936 vs. NCBI nr
Match: gi|659085556|ref|XP_008443483.1| (PREDICTED: WAT1-related protein At4g15540-like isoform X2 [Cucumis melo]) HSP 1 Score: 97.1 bits (240), Expect = 9.6e-18 Identity = 47/49 (95.92%), Postives = 47/49 (95.92%), Query Frame = 1
BLAST of MELO3C009936 vs. NCBI nr
Match: gi|778685742|ref|XP_011652265.1| (PREDICTED: WAT1-related protein At5g40240 [Cucumis sativus]) HSP 1 Score: 90.1 bits (222), Expect = 1.2e-15 Identity = 45/49 (91.84%), Postives = 45/49 (91.84%), Query Frame = 1
BLAST of MELO3C009936 vs. NCBI nr
Match: gi|700204507|gb|KGN59640.1| (hypothetical protein Csa_3G835770 [Cucumis sativus]) HSP 1 Score: 90.1 bits (222), Expect = 1.2e-15 Identity = 45/49 (91.84%), Postives = 45/49 (91.84%), Query Frame = 1
BLAST of MELO3C009936 vs. NCBI nr
Match: gi|449446642|ref|XP_004141080.1| (PREDICTED: WAT1-related protein At4g15540-like isoform X1 [Cucumis sativus]) HSP 1 Score: 65.1 bits (157), Expect = 4.0e-08 Identity = 28/49 (57.14%), Postives = 36/49 (73.47%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |