MELO3C009751 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGATTGATATCAAATTTTGTGGCATTACTGCCATTGTTGTTATTGTTGGTGTCTAATTCTAAAGCTCAATCTACGGGTGGTGTTTTTGATGTCACAACATACGATGCTAAACCTAATGCTGATATAACTACGGTATGAGTACTTTAGGTGGATGAACGATTTTAATTGATACAAATTAAAACATTTTAGTTATCAAATGAAATGATTTAATAATTTAAACAGGCTTTGGCAAGTGCATGGAAGGAGGTATGTGCATCAACCACTCCAAGTAAAGTTTTTGGATTCCAAAAGGAAGATATGGATTAA ATGGGATTGATATCAAATTTTGTGGCATTACTGCCATTGTTGTTATTGTTGGTGTCTAATTCTAAAGCTCAATCTACGGGTGGTGTTTTTGATGTCACAACATACGATGCTAAACCTAATGCTGATATAACTACGGCTTTGGCAAGTGCATGGAAGGAGGTATGTGCATCAACCACTCCAAGTAAAGTTTTTGGATTCCAAAAGGAAGATATGGATTAA ATGGGATTGATATCAAATTTTGTGGCATTACTGCCATTGTTGTTATTGTTGGTGTCTAATTCTAAAGCTCAATCTACGGGTGGTGTTTTTGATGTCACAACATACGATGCTAAACCTAATGCTGATATAACTACGGCTTTGGCAAGTGCATGGAAGGAGGTATGTGCATCAACCACTCCAAGTAAAGTTTTTGGATTCCAAAAGGAAGATATGGATTAA MGLISNFVALLPLLLLLVSNSKAQSTGGVFDVTTYDAKPNADITTALASAWKEVCASTTPSKVFGFQKEDMD*
BLAST of MELO3C009751 vs. Swiss-Prot
Match: PGLR_TOBAC (Polygalacturonase OS=Nicotiana tabacum GN=PG1 PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 9.4e-06 Identity = 25/50 (50.00%), Postives = 31/50 (62.00%), Query Frame = 1
BLAST of MELO3C009751 vs. Swiss-Prot
Match: PGLR_MEDSA (Polygalacturonase OS=Medicago sativa PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 9.4e-06 Identity = 25/55 (45.45%), Postives = 32/55 (58.18%), Query Frame = 1
BLAST of MELO3C009751 vs. TrEMBL
Match: E3VSV7_CUCPE (Polygalacturonase OS=Cucurbita pepo GN=PG1 PE=2 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 4.8e-17 Identity = 45/63 (71.43%), Postives = 52/63 (82.54%), Query Frame = 1
BLAST of MELO3C009751 vs. TrEMBL
Match: A0A151RS47_CAJCA (Polygalacturonase OS=Cajanus cajan GN=KK1_033140 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.1e-08 Identity = 33/56 (58.93%), Postives = 41/56 (73.21%), Query Frame = 1
BLAST of MELO3C009751 vs. TrEMBL
Match: A0A0A0KF15_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G434410 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.8e-08 Identity = 38/62 (61.29%), Postives = 40/62 (64.52%), Query Frame = 1
BLAST of MELO3C009751 vs. TrEMBL
Match: Q9MBC0_SALGI (Polygalacturonase OS=Salix gilgiana GN=SgPG1 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.4e-08 Identity = 39/65 (60.00%), Postives = 45/65 (69.23%), Query Frame = 1
BLAST of MELO3C009751 vs. TrEMBL
Match: A0A0A0LX75_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G066500 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 5.3e-08 Identity = 34/46 (73.91%), Postives = 37/46 (80.43%), Query Frame = 1
BLAST of MELO3C009751 vs. NCBI nr
Match: gi|659097567|ref|XP_008449696.1| (PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Cucumis melo]) HSP 1 Score: 110.5 bits (275), Expect = 1.2e-21 Identity = 55/63 (87.30%), Postives = 57/63 (90.48%), Query Frame = 1
BLAST of MELO3C009751 vs. NCBI nr
Match: gi|659097569|ref|XP_008449697.1| (PREDICTED: exopolygalacturonase-like [Cucumis melo]) HSP 1 Score: 104.8 bits (260), Expect = 6.7e-20 Identity = 54/63 (85.71%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of MELO3C009751 vs. NCBI nr
Match: gi|778717011|ref|XP_011657634.1| (PREDICTED: exopolygalacturonase-like [Cucumis sativus]) HSP 1 Score: 97.8 bits (242), Expect = 8.2e-18 Identity = 53/78 (67.95%), Postives = 55/78 (70.51%), Query Frame = 1
BLAST of MELO3C009751 vs. NCBI nr
Match: gi|659067859|ref|XP_008441641.1| (PREDICTED: exopolygalacturonase-like [Cucumis melo]) HSP 1 Score: 95.9 bits (237), Expect = 3.1e-17 Identity = 50/63 (79.37%), Postives = 54/63 (85.71%), Query Frame = 1
BLAST of MELO3C009751 vs. NCBI nr
Match: gi|310753534|gb|ADP09681.1| (polygalacturonase [Cucurbita pepo]) HSP 1 Score: 94.7 bits (234), Expect = 6.9e-17 Identity = 45/63 (71.43%), Postives = 52/63 (82.54%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |