MELO3C008746 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGAGCCAAAAAAGGACTCTATTATGGATTTCTGACCACATTCTCCATAGGGCCCTCTTATCTCTTCATTCTCCGAGCTTGGGTTATGGAAGAAGGAACTGAGAAGAAAGTATCAGCAACAACAGGTTTTATTACGGGACAACTCATGATGTTCATATCGATCTATTATGCGCCTCTGCATCTAGCATTGGGTAGACCTCATACAATAATTGTCCTAGCTCTACCGTATCTTTTGTTTCATTTCTTCTAGAACAATCACAAACACTTTTTAAATTATGGATCTACTACCAGAAACTCAATGCGTA ATGCGAGCCAAAAAAGGACTCTATTATGGATTTCTGACCACATTCTCCATAGGGCCCTCTTATCTCTTCATTCTCCGAGCTTGGGTTATGGAAGAAGGAACTGAGAAGAAAGTATCAGCAACAACAGGTTTTATTACGGGACAACTCATGATGTTCATATCGATCTATTATGCGCCTCTGCATCTAGCATTGGGTAGACCTCATACAATAATTGTCCTAGCTCTACCGTATCTTTTGTTTCATTTCTTCTAGAACAATCACAAACACTTTTTAAATTATGGATCTACTACCAGAAACTCAATGCGTA ATGCGAGCCAAAAAAGGACTCTATTATGGATTTCTGACCACATTCTCCATAGGGCCCTCTTATCTCTTCATTCTCCGAGCTTGGGTTATGGAAGAAGGAACTGAGAAGAAAGTATCAGCAACAACAGGTTTTATTACGGGACAACTCATGATGTTCATATCGATCTATTATGCGCCTCTGCATCTAGCATTGGGTAGACCTCATACAATAATTGTCCTAGCTCTACCGTATCTTTTGTTTCATTTCTTCTAG MRAKKGLYYGFLTTFSIGPSYLFILRAWVMEEGTEKKVSATTGFITGQLMMFISIYYAPLHLALGRPHTIIVLALPYLLFHFF*
BLAST of MELO3C008746 vs. Swiss-Prot
Match: TI214_CUCSA (Protein TIC 214 OS=Cucumis sativus GN=TIC214 PE=3 SV=2) HSP 1 Score: 156.0 bits (393), Expect = 1.8e-37 Identity = 74/78 (94.87%), Postives = 75/78 (96.15%), Query Frame = 1
BLAST of MELO3C008746 vs. Swiss-Prot
Match: TI214_NICSY (Protein TIC 214 OS=Nicotiana sylvestris GN=TIC214 PE=3 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 5.3e-37 Identity = 75/78 (96.15%), Postives = 74/78 (94.87%), Query Frame = 1
BLAST of MELO3C008746 vs. Swiss-Prot
Match: TI214_NICTO (Protein TIC 214 OS=Nicotiana tomentosiformis GN=TIC214 PE=3 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 5.3e-37 Identity = 75/78 (96.15%), Postives = 74/78 (94.87%), Query Frame = 1
BLAST of MELO3C008746 vs. Swiss-Prot
Match: TI214_SOLTU (Protein TIC 214 OS=Solanum tuberosum GN=TIC214 PE=3 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 5.3e-37 Identity = 75/78 (96.15%), Postives = 74/78 (94.87%), Query Frame = 1
BLAST of MELO3C008746 vs. Swiss-Prot
Match: TI214_SOLBU (Protein TIC 214 OS=Solanum bulbocastanum GN=TIC214 PE=3 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 5.3e-37 Identity = 75/78 (96.15%), Postives = 74/78 (94.87%), Query Frame = 1
BLAST of MELO3C008746 vs. TrEMBL
Match: A0A0N7CK09_SOLCO (Ycf1 OS=Solanum commersonii GN=ycf1 PE=4 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 5.9e-35 Identity = 75/78 (96.15%), Postives = 76/78 (97.44%), Query Frame = 1
BLAST of MELO3C008746 vs. TrEMBL
Match: A0A165TPQ1_9SOLA (Hypothetical chloroplast RF19 OS=Iochroma umbellatum GN=ycf1 PE=4 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 5.9e-35 Identity = 75/78 (96.15%), Postives = 76/78 (97.44%), Query Frame = 1
BLAST of MELO3C008746 vs. TrEMBL
Match: A0A144YW14_9SOLA (Hypothetical chloroplast RF19 OS=Iochroma lehmannii GN=ycf1 PE=4 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 5.9e-35 Identity = 75/78 (96.15%), Postives = 76/78 (97.44%), Query Frame = 1
BLAST of MELO3C008746 vs. TrEMBL
Match: A0A144YWC3_9SOLA (Hypothetical chloroplast RF19 OS=Iochroma lehmannii GN=ycf1 PE=4 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 5.9e-35 Identity = 75/78 (96.15%), Postives = 76/78 (97.44%), Query Frame = 1
BLAST of MELO3C008746 vs. TrEMBL
Match: A0A060D4V1_9GENT (Hypothetical chloroplast RF1 OS=Rhazya stricta GN=ycf1 PE=4 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 5.9e-35 Identity = 75/78 (96.15%), Postives = 76/78 (97.44%), Query Frame = 1
BLAST of MELO3C008746 vs. TAIR10
Match: ATCG01130.1 (ATCG01130.1 Ycf1 protein) HSP 1 Score: 146.7 bits (369), Expect = 6.2e-36 Identity = 74/81 (91.36%), Postives = 73/81 (90.12%), Query Frame = 1
BLAST of MELO3C008746 vs. TAIR10
Match: ATCG01000.1 (ATCG01000.1 Ycf1 protein) HSP 1 Score: 146.7 bits (369), Expect = 6.2e-36 Identity = 74/81 (91.36%), Postives = 73/81 (90.12%), Query Frame = 1
BLAST of MELO3C008746 vs. TAIR10
Match: ATMG00370.1 (ATMG00370.1 Ycf1 protein) HSP 1 Score: 146.7 bits (369), Expect = 6.2e-36 Identity = 74/81 (91.36%), Postives = 73/81 (90.12%), Query Frame = 1
BLAST of MELO3C008746 vs. TAIR10
Match: AT2G07739.1 (AT2G07739.1 Ycf1 protein) HSP 1 Score: 144.4 bits (363), Expect = 3.1e-35 Identity = 73/81 (90.12%), Postives = 72/81 (88.89%), Query Frame = 1
BLAST of MELO3C008746 vs. NCBI nr
Match: gi|74027156|gb|AAZ94706.1| (hypothetical protein [Cucumis sativus]) HSP 1 Score: 156.0 bits (393), Expect = 2.9e-35 Identity = 74/78 (94.87%), Postives = 77/78 (98.72%), Query Frame = 1
BLAST of MELO3C008746 vs. NCBI nr
Match: gi|68164850|ref|YP_247646.1| (hypothetical protein CsCp100 [Cucumis sativus]) HSP 1 Score: 156.0 bits (393), Expect = 2.9e-35 Identity = 74/78 (94.87%), Postives = 77/78 (98.72%), Query Frame = 1
BLAST of MELO3C008746 vs. NCBI nr
Match: gi|158518591|sp|Q4VZL0.2|TI214_CUCSA (RecName: Full=Protein TIC 214; AltName: Full=Translocon at the inner envelope membrane of chloroplasts 214; Short=AtTIC214) HSP 1 Score: 156.0 bits (393), Expect = 2.9e-35 Identity = 74/78 (94.87%), Postives = 77/78 (98.72%), Query Frame = 1
BLAST of MELO3C008746 vs. NCBI nr
Match: gi|68164862|ref|YP_247658.1| (hypothetical protein CsCp113 [Cucumis sativus]) HSP 1 Score: 156.0 bits (393), Expect = 2.9e-35 Identity = 74/78 (94.87%), Postives = 77/78 (98.72%), Query Frame = 1
BLAST of MELO3C008746 vs. NCBI nr
Match: gi|641803868|gb|AIA77019.1| (hypothetical chloroplast RF19 (chloroplast) (chloroplast) [Capsicum annuum var. glabriusculum]) HSP 1 Score: 154.5 bits (389), Expect = 8.5e-35 Identity = 75/78 (96.15%), Postives = 76/78 (97.44%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|