MELO3C008724 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.TCAAGATATGCCTAGATCAAATTTCAATGTGGAATTGGACGCTGCCAATGCTACGTGGTTGGTAAATGATGTGGCCTTGCTGTCAACCAAGACTGGGGAGCTATTATTGCTGGCACTTGTTTATGATGGACGGTGAGCACTTCCATTTTTCATGATGCTCATATATTTTCCATTTCATAGCTTCACCATCATAATTGTCAGCTTCTCTCATGCTAACATTTTGAGGATGGAATAATACTCTGATTTGCAGGGTTGTGCAAAGACTTGATCTTTCAAAGTCTAAAGCTTCAGTACTTGCATCGGTTAGTTTGATGCTACTTTATCCTACTATTTTAGTTTCTAGTTTGATTAAAAAACGAGGTTCATGTATGACTATATAAATTCTCTTTTATTATCGATAGGGAACTTTACAGAATATTGAAACTGATCTTTATGTACATCTTGTTGAAATGATATGTAGGGTATCGCATCAATTGGAAATTCATTATTTTTTCTGGGCAGTCGATTGGGAGATAGTTTACTTGTGCAGTTTAGTTGTGGAGTGGGATCCTCAGGATTGGCATCCAATTTAAAGGACGAGGTTTGTTGGGATCCATAA TCAAGATATGCCTAGATCAAATTTCAATGTGGAATTGGACGCTGCCAATGCTACGTGGTTGGTAAATGATGTGGCCTTGCTGTCAACCAAGACTGGGGAGCTATTATTGCTGGCACTTGTTTATGATGGACGGGTTGTGCAAAGACTTGATCTTTCAAAGTCTAAAGCTTCAGTACTTGCATCGGGTATCGCATCAATTGGAAATTCATTATTTTTTCTGGGCAGTCGATTGGGAGATAGTTTACTTGTGCAGTTTAGTTGTGGAGTGGGATCCTCAGGATTGGCATCCAATTTAAAGGACGAGGTTTGTTGGGATCCATAA TCAAGATATGCCTAGATCAAATTTCAATGTGGAATTGGACGCTGCCAATGCTACGTGGTTGGTAAATGATGTGGCCTTGCTGTCAACCAAGACTGGGGAGCTATTATTGCTGGCACTTGTTTATGATGGACGGGTTGTGCAAAGACTTGATCTTTCAAAGTCTAAAGCTTCAGTACTTGCATCGGGTATCGCATCAATTGGAAATTCATTATTTTTTCTGGGCAGTCGATTGGGAGATAGTTTACTTGTGCAGTTTAGTTGTGGAGTGGGATCCTCAGGATTGGCATCCAATTTAAAGGACGAGGTTTGTTGGGATCCATAA QDMPRSNFNVELDAANATWLVNDVALLSTKTGELLLLALVYDGRVVQRLDLSKSKASVLASGIASIGNSLFFLGSRLGDSLLVQFSCGVGSSGLASNLKDEVCWDP*
BLAST of MELO3C008724 vs. Swiss-Prot
Match: CPSF1_ARATH (Cleavage and polyadenylation specificity factor subunit 1 OS=Arabidopsis thaliana GN=CPSF160 PE=1 SV=2) HSP 1 Score: 150.6 bits (379), Expect = 9.8e-36 Identity = 76/101 (75.25%), Postives = 84/101 (83.17%), Query Frame = 1
BLAST of MELO3C008724 vs. Swiss-Prot
Match: CPSF1_ORYSJ (Probable cleavage and polyadenylation specificity factor subunit 1 OS=Oryza sativa subsp. japonica GN=Os04g0252200 PE=3 SV=2) HSP 1 Score: 129.8 bits (325), Expect = 1.8e-29 Identity = 64/85 (75.29%), Postives = 72/85 (84.71%), Query Frame = 1
BLAST of MELO3C008724 vs. Swiss-Prot
Match: CPSF1_DROME (Cleavage and polyadenylation specificity factor subunit 1 OS=Drosophila melanogaster GN=Cpsf160 PE=1 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 3.9e-08 Identity = 33/84 (39.29%), Postives = 47/84 (55.95%), Query Frame = 1
BLAST of MELO3C008724 vs. Swiss-Prot
Match: CPSF1_HUMAN (Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens GN=CPSF1 PE=1 SV=2) HSP 1 Score: 57.8 bits (138), Expect = 8.6e-08 Identity = 31/78 (39.74%), Postives = 48/78 (61.54%), Query Frame = 1
BLAST of MELO3C008724 vs. Swiss-Prot
Match: CPSF1_BOVIN (Cleavage and polyadenylation specificity factor subunit 1 OS=Bos taurus GN=CPSF1 PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 3.3e-07 Identity = 30/78 (38.46%), Postives = 47/78 (60.26%), Query Frame = 1
BLAST of MELO3C008724 vs. TrEMBL
Match: A0A0A0LKI9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G074280 PE=4 SV=1) HSP 1 Score: 192.6 bits (488), Expect = 2.5e-46 Identity = 100/101 (99.01%), Postives = 100/101 (99.01%), Query Frame = 1
BLAST of MELO3C008724 vs. TrEMBL
Match: M5X6F1_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa000211mg PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 1.0e-39 Identity = 86/102 (84.31%), Postives = 94/102 (92.16%), Query Frame = 1
BLAST of MELO3C008724 vs. TrEMBL
Match: A0A072UAN0_MEDTR (Cleavage and polyadenylation specificity factor subunit 1 OS=Medicago truncatula GN=MTR_6g461810 PE=4 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 1.3e-39 Identity = 85/102 (83.33%), Postives = 96/102 (94.12%), Query Frame = 1
BLAST of MELO3C008724 vs. TrEMBL
Match: A0A0R0FSW8_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_16G203900 PE=4 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 5.0e-39 Identity = 86/102 (84.31%), Postives = 96/102 (94.12%), Query Frame = 1
BLAST of MELO3C008724 vs. TrEMBL
Match: A0A0R0G307_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_16G203900 PE=4 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 5.0e-39 Identity = 86/102 (84.31%), Postives = 96/102 (94.12%), Query Frame = 1
BLAST of MELO3C008724 vs. TAIR10
Match: AT5G51660.1 (AT5G51660.1 cleavage and polyadenylation specificity factor 160) HSP 1 Score: 150.6 bits (379), Expect = 5.5e-37 Identity = 76/101 (75.25%), Postives = 84/101 (83.17%), Query Frame = 1
BLAST of MELO3C008724 vs. NCBI nr
Match: gi|659082458|ref|XP_008441851.1| (PREDICTED: cleavage and polyadenylation specificity factor subunit 1 isoform X2 [Cucumis melo]) HSP 1 Score: 194.1 bits (492), Expect = 1.2e-46 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 1
BLAST of MELO3C008724 vs. NCBI nr
Match: gi|659082456|ref|XP_008441850.1| (PREDICTED: cleavage and polyadenylation specificity factor subunit 1 isoform X1 [Cucumis melo]) HSP 1 Score: 194.1 bits (492), Expect = 1.2e-46 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 1
BLAST of MELO3C008724 vs. NCBI nr
Match: gi|778667872|ref|XP_011648998.1| (PREDICTED: cleavage and polyadenylation specificity factor subunit 1 [Cucumis sativus]) HSP 1 Score: 192.6 bits (488), Expect = 3.6e-46 Identity = 100/101 (99.01%), Postives = 100/101 (99.01%), Query Frame = 1
BLAST of MELO3C008724 vs. NCBI nr
Match: gi|1009122186|ref|XP_015877866.1| (PREDICTED: cleavage and polyadenylation specificity factor subunit 1 [Ziziphus jujuba]) HSP 1 Score: 174.5 bits (441), Expect = 1.0e-40 Identity = 89/102 (87.25%), Postives = 97/102 (95.10%), Query Frame = 1
BLAST of MELO3C008724 vs. NCBI nr
Match: gi|596047741|ref|XP_007220310.1| (hypothetical protein PRUPE_ppa000211mg [Prunus persica]) HSP 1 Score: 170.6 bits (431), Expect = 1.5e-39 Identity = 86/102 (84.31%), Postives = 94/102 (92.16%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|