MELO3C008625 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGCGATGGCGAGGGCGAGCTCCGACTTGCAATATCCCGACCGGTTCTACATTGCAGCTTCTTATGCCGGTTTTGATGGATCACTAAAATCGTCTTCAAAGGCCCTCAGGTCTATGTTCTCCGATGAGGCCGCTTTGTTACTTTATGGCTTGTATCAGCAGGTACTACCACATGTTCTTACACCTGTGACTTACCGGTGCTGTTTCAGTTTGTGTTGA ATGGCTGCGATGGCGAGGGCGAGCTCCGACTTGCAATATCCCGACCGGTTCTACATTGCAGCTTCTTATGCCGGTTTTGATGGATCACTAAAATCGTCTTCAAAGGCCCTCAGGTCTATGTTCTCCGATGAGGCCGCTTTGTTACTTTATGGCTTGTATCAGCAGGTACTACCACATGTTCTTACACCTGTGACTTACCGGTGCTGTTTCAGTTTGTGTTGA ATGGCTGCGATGGCGAGGGCGAGCTCCGACTTGCAATATCCCGACCGGTTCTACATTGCAGCTTCTTATGCCGGTTTTGATGGATCACTAAAATCGTCTTCAAAGGCCCTCAGGTCTATGTTCTCCGATGAGGCCGCTTTGTTACTTTATGGCTTGTATCAGCAGGTACTACCACATGTTCTTACACCTGTGACTTACCGGTGCTGTTTCAGTTTGTGTTGA MAAMARASSDLQYPDRFYIAASYAGFDGSLKSSSKALRSMFSDEAALLLYGLYQQVLPHVLTPVTYRCCFSLC*
BLAST of MELO3C008625 vs. Swiss-Prot
Match: ACBP5_ARATH (Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 2.9e-10 Identity = 35/55 (63.64%), Postives = 39/55 (70.91%), Query Frame = 1
BLAST of MELO3C008625 vs. Swiss-Prot
Match: ACBP4_ARATH (Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 4.1e-09 Identity = 33/53 (62.26%), Postives = 36/53 (67.92%), Query Frame = 1
BLAST of MELO3C008625 vs. TrEMBL
Match: A0A0A0LFW3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G030060 PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 2.6e-18 Identity = 51/55 (92.73%), Postives = 51/55 (92.73%), Query Frame = 1
BLAST of MELO3C008625 vs. TrEMBL
Match: M5WQY4_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa002406mg PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 8.6e-14 Identity = 41/53 (77.36%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of MELO3C008625 vs. TrEMBL
Match: D7U9T2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_14s0060g02410 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 2.1e-12 Identity = 40/53 (75.47%), Postives = 43/53 (81.13%), Query Frame = 1
BLAST of MELO3C008625 vs. TrEMBL
Match: A0A067EMH1_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0066451mg PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 6.2e-12 Identity = 39/53 (73.58%), Postives = 44/53 (83.02%), Query Frame = 1
BLAST of MELO3C008625 vs. TrEMBL
Match: V4T0M2_9ROSI (Uncharacterized protein (Fragment) OS=Citrus clementina GN=CICLE_v100005042mg PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 6.2e-12 Identity = 39/53 (73.58%), Postives = 44/53 (83.02%), Query Frame = 1
BLAST of MELO3C008625 vs. TAIR10
Match: AT5G27630.1 (AT5G27630.1 acyl-CoA binding protein 5) HSP 1 Score: 65.5 bits (158), Expect = 1.6e-11 Identity = 35/55 (63.64%), Postives = 39/55 (70.91%), Query Frame = 1
BLAST of MELO3C008625 vs. TAIR10
Match: AT3G05420.2 (AT3G05420.2 acyl-CoA binding protein 4) HSP 1 Score: 61.6 bits (148), Expect = 2.3e-10 Identity = 33/53 (62.26%), Postives = 36/53 (67.92%), Query Frame = 1
BLAST of MELO3C008625 vs. NCBI nr
Match: gi|449454077|ref|XP_004144782.1| (PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform X1 [Cucumis sativus]) HSP 1 Score: 99.0 bits (245), Expect = 3.7e-18 Identity = 51/55 (92.73%), Postives = 51/55 (92.73%), Query Frame = 1
BLAST of MELO3C008625 vs. NCBI nr
Match: gi|778666903|ref|XP_011648837.1| (PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis sativus]) HSP 1 Score: 99.0 bits (245), Expect = 3.7e-18 Identity = 51/55 (92.73%), Postives = 51/55 (92.73%), Query Frame = 1
BLAST of MELO3C008625 vs. NCBI nr
Match: gi|659070286|ref|XP_008454347.1| (PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform X2 [Cucumis melo]) HSP 1 Score: 99.0 bits (245), Expect = 3.7e-18 Identity = 51/55 (92.73%), Postives = 51/55 (92.73%), Query Frame = 1
BLAST of MELO3C008625 vs. NCBI nr
Match: gi|659070284|ref|XP_008454338.1| (PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform X1 [Cucumis melo]) HSP 1 Score: 99.0 bits (245), Expect = 3.7e-18 Identity = 51/55 (92.73%), Postives = 51/55 (92.73%), Query Frame = 1
BLAST of MELO3C008625 vs. NCBI nr
Match: gi|659125410|ref|XP_008462673.1| (PREDICTED: acyl-CoA-binding domain-containing protein 5-like [Cucumis melo]) HSP 1 Score: 93.6 bits (231), Expect = 1.6e-16 Identity = 48/55 (87.27%), Postives = 48/55 (87.27%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|