MELO3C008613 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAACATGAAGTCTCATATTTGGTATTCAATTGTGGTTTATGTTATAGTGTTAAGCTTGGAAGGTAAAAGTAGGGTTTTTGGAGAGCCTCGAGCACCTTGTTACTTCATATTTGGTGACTCTTTGTCAGATAATGGGAACAACAATAATCTTGTAACTAGAGCTAAAGCAAATTATATACCTTATGGTATCGACTTTCCAGAAGGTACTACCGGGAGATTTTCTAACGGTGGAAACGTTGTTGATTTTATTG ATGAACATGAAGTCTCATATTTGGTATTCAATTGTGGTTTATGTTATAGTGTTAAGCTTGGAAGGTAAAAGTAGGGTTTTTGGAGAGCCTCGAGCACCTTGTTACTTCATATTTGGTGACTCTTTGTCAGATAATGGGAACAACAATAATCTTGTAACTAGAGCTAAAGCAAATTATATACCTTATGGTATCGACTTTCCAGAAGGTACTACCGGGAGATTTTCTAACGGTGGAAACGTTGTTGATTTTATTG ATGAACATGAAGTCTCATATTTGGTATTCAATTGTGGTTTATGTTATAGTGTTAAGCTTGGAAGGTAAAAGTAGGGTTTTTGGAGAGCCTCGAGCACCTTGTTACTTCATATTTGGTGACTCTTTGTCAGATAATGGGAACAACAATAATCTTGTAACTAGAGCTAAAGCAAATTATATACCTTATGGTATCGACTTTCCAGAAGGTACTACCGGGAGATTTTCTAACGGTGGAAACGTTGTTGATTTTATTG MNMKSHIWYSIVVYVIVLSLEGKSRVFGEPRAPCYFIFGDSLSDNGNNNNLVTRAKANYIPYGIDFPEGTTGRFSNGGNVVDFI
BLAST of MELO3C008613 vs. Swiss-Prot
Match: GDL82_ARATH (GDSL esterase/lipase At5g45670 OS=Arabidopsis thaliana GN=At5g45670 PE=2 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 2.7e-17 Identity = 42/75 (56.00%), Postives = 52/75 (69.33%), Query Frame = 1
BLAST of MELO3C008613 vs. Swiss-Prot
Match: GDL65_ARATH (GDSL esterase/lipase At4g18970 OS=Arabidopsis thaliana GN=At4g18970 PE=2 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 4.7e-17 Identity = 40/57 (70.18%), Postives = 42/57 (73.68%), Query Frame = 1
BLAST of MELO3C008613 vs. Swiss-Prot
Match: GDL14_ARATH (GDSL esterase/lipase At1g29660 OS=Arabidopsis thaliana GN=At1g29660 PE=1 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 8.0e-17 Identity = 47/84 (55.95%), Postives = 57/84 (67.86%), Query Frame = 1
BLAST of MELO3C008613 vs. Swiss-Prot
Match: GDL35_ARATH (GDSL esterase/lipase At2g19010 OS=Arabidopsis thaliana GN=At2g19010 PE=2 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.0e-16 Identity = 38/59 (64.41%), Postives = 46/59 (77.97%), Query Frame = 1
BLAST of MELO3C008613 vs. Swiss-Prot
Match: GDL37_ARATH (GDSL esterase/lipase At2g19060 OS=Arabidopsis thaliana GN=At2g19060 PE=2 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.4e-16 Identity = 42/81 (51.85%), Postives = 49/81 (60.49%), Query Frame = 1
BLAST of MELO3C008613 vs. TrEMBL
Match: A0A0A0LH81_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G078090 PE=4 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 1.8e-31 Identity = 70/87 (80.46%), Postives = 73/87 (83.91%), Query Frame = 1
BLAST of MELO3C008613 vs. TrEMBL
Match: D7SS09_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_09s0054g00850 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 3.7e-21 Identity = 50/73 (68.49%), Postives = 58/73 (79.45%), Query Frame = 1
BLAST of MELO3C008613 vs. TrEMBL
Match: A0A067DXD5_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0415922mg PE=4 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 3.1e-20 Identity = 48/72 (66.67%), Postives = 56/72 (77.78%), Query Frame = 1
BLAST of MELO3C008613 vs. TrEMBL
Match: A0A059CKH3_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_C00133 PE=4 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 7.0e-20 Identity = 48/77 (62.34%), Postives = 56/77 (72.73%), Query Frame = 1
BLAST of MELO3C008613 vs. TrEMBL
Match: A0A068TLV1_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00014095001 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.6e-19 Identity = 48/74 (64.86%), Postives = 56/74 (75.68%), Query Frame = 1
BLAST of MELO3C008613 vs. TAIR10
Match: AT5G45670.1 (AT5G45670.1 GDSL-like Lipase/Acylhydrolase superfamily protein) HSP 1 Score: 89.0 bits (219), Expect = 1.5e-18 Identity = 42/75 (56.00%), Postives = 52/75 (69.33%), Query Frame = 1
BLAST of MELO3C008613 vs. TAIR10
Match: AT4G18970.2 (AT4G18970.2 GDSL-like Lipase/Acylhydrolase superfamily protein) HSP 1 Score: 88.2 bits (217), Expect = 2.6e-18 Identity = 40/57 (70.18%), Postives = 42/57 (73.68%), Query Frame = 1
BLAST of MELO3C008613 vs. TAIR10
Match: AT1G29660.1 (AT1G29660.1 GDSL-like Lipase/Acylhydrolase superfamily protein) HSP 1 Score: 87.4 bits (215), Expect = 4.5e-18 Identity = 47/84 (55.95%), Postives = 57/84 (67.86%), Query Frame = 1
BLAST of MELO3C008613 vs. TAIR10
Match: AT2G19010.1 (AT2G19010.1 GDSL-like Lipase/Acylhydrolase superfamily protein) HSP 1 Score: 87.0 bits (214), Expect = 5.9e-18 Identity = 38/59 (64.41%), Postives = 46/59 (77.97%), Query Frame = 1
BLAST of MELO3C008613 vs. TAIR10
Match: AT2G19060.1 (AT2G19060.1 SGNH hydrolase-type esterase superfamily protein) HSP 1 Score: 86.7 bits (213), Expect = 7.7e-18 Identity = 42/81 (51.85%), Postives = 49/81 (60.49%), Query Frame = 1
BLAST of MELO3C008613 vs. NCBI nr
Match: gi|659082311|ref|XP_008441774.1| (PREDICTED: GDSL esterase/lipase At1g29670-like [Cucumis melo]) HSP 1 Score: 177.9 bits (450), Expect = 7.2e-42 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of MELO3C008613 vs. NCBI nr
Match: gi|778667990|ref|XP_011649022.1| (PREDICTED: GDSL esterase/lipase At1g29670-like isoform X2 [Cucumis sativus]) HSP 1 Score: 142.9 bits (359), Expect = 2.6e-31 Identity = 70/87 (80.46%), Postives = 73/87 (83.91%), Query Frame = 1
BLAST of MELO3C008613 vs. NCBI nr
Match: gi|778667987|ref|XP_004152864.2| (PREDICTED: GDSL esterase/lipase At1g29670-like isoform X1 [Cucumis sativus]) HSP 1 Score: 142.9 bits (359), Expect = 2.6e-31 Identity = 70/87 (80.46%), Postives = 73/87 (83.91%), Query Frame = 1
BLAST of MELO3C008613 vs. NCBI nr
Match: gi|225443389|ref|XP_002266915.1| (PREDICTED: GDSL esterase/lipase At1g29670 [Vitis vinifera]) HSP 1 Score: 108.6 bits (270), Expect = 5.3e-21 Identity = 50/73 (68.49%), Postives = 58/73 (79.45%), Query Frame = 1
BLAST of MELO3C008613 vs. NCBI nr
Match: gi|641823888|gb|KDO43261.1| (hypothetical protein CISIN_1g0415922mg, partial [Citrus sinensis]) HSP 1 Score: 105.5 bits (262), Expect = 4.5e-20 Identity = 48/72 (66.67%), Postives = 56/72 (77.78%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|